SecReT4
Protein ID: 259909649
T4SS name [ID]Tfc [756]
Gene symbol-
Locus tagEpC_30240
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T4SS(s) in this replicon]
Location [Strand]3320578..3320985 [-]
Producthypothetical protein
Component typeTfc24
UniProt IDD0FVV9
KEGG IDepy:EpC_30240
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 4e-40, Aligned region: 19..132
Protein Sequence: 135 a.a.     [Download]
>gi|259909649|ref|YP_002650005.1| hypothetical protein EpC_30240 [Erwinia pyrifoliae Ep1/96]
MKIPVCCLAALFLSSGTLAGTVIYTDNAHPVADGLAADVTVVELDAPDRLQAQLFGELPTDPVQAERQAR
AVIASPLFLQRQQQLAGKYAGVTRAWSLGLEKYPAVVFDDKWVVYGTTDVAVATRQLNVWKEKAE
 
Nucleotide Sequence: 408 bp     [Download]
>gi|259906682|ref|NC_012214.1|:c3320985-3320578 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGAAAATACCCGTCTGCTGCCTGGCAGCACTGTTCCTTTCCTCCGGCACCCTGGCCGGCACCGTTATTT
ATACCGACAATGCGCATCCCGTCGCCGATGGCCTCGCTGCGGACGTTACCGTCGTCGAGCTTGATGCCCC
CGACCGTTTGCAGGCGCAGCTGTTTGGCGAACTGCCCACTGACCCTGTGCAGGCAGAGCGGCAGGCGCGT
GCGGTGATAGCTTCGCCCCTCTTTCTGCAGCGCCAACAGCAGCTGGCCGGGAAGTATGCCGGCGTGACCC
GTGCCTGGTCGCTGGGGTTGGAGAAATATCCCGCCGTGGTTTTTGACGATAAGTGGGTGGTGTACGGTAC
CACCGACGTCGCCGTAGCAACGCGGCAGCTGAATGTCTGGAAGGAGAAAGCTGAATGA
 Primer design