SecReT4
Protein ID: 259909655
T4SS name [ID]Tfc [756]
Gene symbol-
Locus tagEpC_30300
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T4SS(s) in this replicon]
Location [Strand]3330423..3330827 [-]
Producthypothetical protein
Component typeTfc17
UniProt IDD0FVW5
KEGG IDepy:EpC_30300
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 134 a.a.     [Download]
>gi|259909655|ref|YP_002650011.1| hypothetical protein EpC_30300 [Erwinia pyrifoliae Ep1/96]
MKKLTMTPPMVVPDKALIASVIFTVPPQGTASVGQSDRRSLDQLQSEILNRLEKPVLLSVYPHRVGRRSC
VAVHLSDVQDKTLDILVTVTGNTLWPGESEYRTGIRWNICVPDATDMLWVLKEIDRVTGERGDK
 
Nucleotide Sequence: 405 bp     [Download]
>gi|259906682|ref|NC_012214.1|:c3330827-3330423 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGAAAAAGCTGACCATGACACCGCCGATGGTCGTGCCTGACAAGGCGCTGATCGCTTCCGTTATTTTTA
CCGTGCCGCCGCAGGGTACGGCATCCGTTGGCCAGTCTGACCGTCGGTCGCTTGACCAGCTACAGAGTGA
AATCCTCAACCGGCTGGAGAAACCGGTGCTGCTGTCGGTCTATCCACACCGCGTTGGCCGGCGCAGCTGC
GTGGCGGTGCATCTCTCTGACGTGCAGGATAAGACGCTGGATATTCTGGTCACCGTCACCGGTAATACGC
TGTGGCCGGGTGAATCCGAATACAGAACGGGTATCCGCTGGAATATCTGTGTGCCCGATGCAACGGATAT
GCTCTGGGTGCTGAAGGAGATTGACCGGGTAACCGGCGAGCGGGGGGATAAGTAG
 Primer design