SecReT4
Protein ID: 259909656
T4SS name [ID]Tfc [756]
Gene symbol-
Locus tagEpC_30310
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T4SS(s) in this replicon]
Location [Strand]3330839..3333640 [-]
Productplasmid-like protein
Component typeTfc16
UniProt IDD0FVW6
KEGG IDepy:EpC_30310
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 2.9e-58, Aligned region: 49..315
AAA_10 [PF12846], Evalue: 9.4e-43, Aligned region: 508..851
Protein Sequence: 933 a.a.     [Download]
>gi|259909656|ref|YP_002650012.1| plasmid-like protein [Erwinia pyrifoliae Ep1/96]
MTFPLFRRRPKRQDAHQYGDGPFAVNGHQPLTRDGRLTRTDEARLYATAPSVIDHVPWGEYLPEHQCLLL
DDGVSVGAVYEIIPTGTEGRPASRLDEIRDVVENALQDSLPELDSHQWVVQFYCQDESDLSSYMDKVRGY
VRPWAQGTAFTEAWLSEQARHLQNVAVEQGLFMDDAVTGAPWRGQMRRTRMVVYRWVETPYRDPMAPEVL
LNQVCDRLTAAISGAGIQSQRQNGEQIHSWLLRWFNPEPQWVDKATLYRCARYRDDAPGDLPLLNDFSES
LWFTRPRSNAEKGVWWFDDVAHKAVPVARLRTAPSTGHLTGEVRRGDNINAIMDLLPQGTVLTLTLVIQP
QDKLEENFARLSRDSMGENVDSLRAREDAARARTFLGNKHKLYRAAISLLIKARDLETLDKRYLDLSSKL
LNCGLEPVNPEHDIGPLSGYLRALPMCFNPQQDRHHWYTRLMFVQHFACLAPVYGRDTGTGNPGFTFFNR
GGGPLSVDPLNKNDRTQNAHKLLFGPTGAGKSATALCELAQMMAIYRPRIFLLEAGNSFGLFGDYCASLG
LTVHRVSIKPGKVISLAPFGDSHLLMQARPDALLVSEEALPDIDEDDEDKDEERDVLGEMEIAARLMITG
GEAAEEARMTRADRGMIREAILIAARTAFGADRQMLPEDLMYALQNIARDVSTGDDGREKRTPARRARAE
EMSEALRMFTEGFEGELFNRPGTPWPEADVTIVDLGTLAREGYEAQMAVAVISLLNTINNIAEREQYSDR
ETLVPIDEAHIVTANPLLGPYATKIVKMWRKLGAWLWLFTQNLADFPDTAKKMLNMAEWWICLVMPPDEV
EQIARFKTLTDEQKTMLLSATKLPRKYTEGVILSRKVQALFRAVPPSLYLALGVTEKEEKAERRSIMNEH
HCSELEAAFHVARRLDESRGMVI
 
Nucleotide Sequence: 2802 bp     [Download]
>gi|259906682|ref|NC_012214.1|:c3333640-3330839 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGACATTCCCTCTTTTCCGCCGCAGGCCGAAGCGGCAGGACGCACACCAGTACGGTGACGGGCCGTTTG
CCGTAAACGGTCATCAACCCCTGACCCGCGACGGACGCCTGACGCGCACCGACGAAGCGCGTCTGTACGC
TACCGCACCGTCGGTTATCGATCATGTGCCGTGGGGCGAGTACCTCCCGGAACACCAGTGCCTGCTGCTT
GATGACGGCGTGTCGGTTGGCGCGGTGTATGAAATTATCCCGACGGGCACCGAGGGGCGTCCTGCATCGC
GACTGGACGAGATCCGCGACGTGGTGGAAAACGCGCTGCAGGACAGCCTGCCGGAGCTAGACTCCCATCA
GTGGGTGGTGCAGTTTTACTGTCAGGACGAATCTGACCTCTCCTCTTATATGGATAAGGTCAGGGGCTAC
GTCAGGCCGTGGGCGCAGGGAACCGCTTTTACCGAAGCCTGGCTCAGCGAACAGGCGCGTCACCTGCAAA
ACGTTGCCGTTGAACAGGGGCTGTTTATGGATGACGCGGTGACCGGAGCCCCCTGGCGCGGGCAGATGCG
CCGCACCCGCATGGTGGTCTATCGCTGGGTGGAAACGCCGTACCGTGACCCGATGGCTCCGGAAGTGCTG
TTGAATCAGGTATGCGACCGGCTGACCGCCGCCATAAGCGGTGCCGGCATCCAGAGCCAGCGCCAGAACG
GCGAGCAGATCCACAGCTGGCTGCTGCGCTGGTTCAATCCCGAACCGCAGTGGGTGGACAAGGCGACGCT
GTATCGCTGCGCCCGCTACCGCGATGATGCGCCGGGCGATCTGCCGCTGCTCAATGATTTCAGCGAAAGC
CTGTGGTTCACCCGTCCGCGCAGCAATGCGGAGAAGGGCGTCTGGTGGTTTGATGACGTGGCGCATAAGG
CGGTGCCGGTTGCCCGTCTGCGTACTGCACCCTCGACCGGGCATTTAACCGGCGAGGTCAGGCGCGGCGA
CAACATCAACGCCATCATGGATCTGCTGCCGCAGGGCACCGTTCTGACGCTGACGCTGGTTATCCAGCCG
CAGGACAAACTGGAGGAGAATTTTGCCCGTCTGAGCCGCGACTCGATGGGGGAGAACGTCGACTCGCTGC
GCGCCCGCGAGGATGCCGCCCGCGCACGAACCTTCCTCGGGAACAAGCATAAGCTCTATCGTGCGGCCAT
CTCGCTGCTCATCAAGGCGCGGGATCTGGAAACCCTCGACAAACGCTATCTCGACCTGAGCAGCAAGCTG
CTGAACTGCGGCCTGGAGCCGGTCAATCCGGAGCATGATATCGGCCCACTCAGCGGCTACCTGCGCGCGC
TGCCCATGTGCTTTAACCCACAGCAGGATCGCCATCACTGGTATACGCGCCTGATGTTCGTTCAGCACTT
TGCCTGCCTGGCACCGGTGTATGGCCGTGATACCGGCACCGGCAACCCGGGCTTTACCTTTTTCAACCGT
GGCGGCGGTCCGCTTTCCGTCGACCCGCTGAATAAAAATGACCGTACCCAGAATGCACATAAGCTGCTGT
TCGGCCCGACCGGTGCCGGTAAGTCGGCTACCGCACTCTGCGAACTGGCGCAGATGATGGCCATCTACCG
GCCGCGCATCTTCCTGCTGGAGGCGGGCAACAGCTTCGGCCTGTTCGGGGATTACTGCGCTTCGCTGGGG
CTGACGGTGCACCGTGTCAGCATCAAGCCCGGCAAGGTCATCTCACTGGCTCCGTTCGGTGATTCGCACC
TGCTGATGCAGGCCAGGCCGGATGCCCTGCTGGTCAGCGAGGAGGCGTTGCCGGATATCGATGAAGACGA
TGAGGACAAGGATGAAGAGCGTGACGTGCTGGGTGAGATGGAGATTGCGGCACGCCTGATGATCACCGGC
GGTGAGGCGGCGGAGGAAGCGCGGATGACGCGCGCCGATCGCGGCATGATCCGCGAGGCGATACTGATTG
CGGCGAGAACCGCTTTTGGCGCAGACCGGCAGATGCTGCCGGAAGACCTGATGTATGCGCTACAGAATAT
CGCGCGTGATGTCAGCACCGGCGACGACGGCCGCGAGAAGCGCACGCCCGCACGCCGCGCCCGTGCCGAA
GAGATGTCGGAAGCGCTGCGCATGTTTACCGAAGGCTTTGAAGGTGAGCTGTTTAACCGTCCCGGCACGC
CGTGGCCGGAGGCCGACGTCACCATCGTCGACCTGGGGACGCTGGCGCGTGAAGGGTATGAGGCCCAGAT
GGCGGTGGCCGTCATCTCTCTGCTCAACACCATTAACAATATCGCCGAGCGCGAGCAGTACAGCGACAGA
GAAACCCTTGTCCCGATCGATGAAGCGCATATCGTCACCGCCAACCCGCTGCTGGGGCCTTACGCCACCA
AGATCGTCAAGATGTGGCGTAAGCTCGGTGCCTGGCTGTGGCTGTTTACCCAGAACCTGGCGGACTTTCC
CGATACGGCGAAAAAGATGCTCAATATGGCGGAGTGGTGGATTTGTCTCGTTATGCCGCCTGACGAGGTG
GAGCAGATAGCGCGCTTTAAGACGCTGACGGACGAGCAAAAGACCATGCTGCTGTCTGCCACCAAACTGC
CGAGAAAATACACCGAGGGCGTGATCCTGTCGCGCAAGGTGCAGGCGCTGTTTCGTGCCGTACCACCGAG
CCTCTATCTGGCGCTGGGGGTGACGGAGAAAGAGGAGAAAGCCGAAAGGCGGTCGATTATGAATGAACAC
CATTGCTCCGAGCTGGAGGCCGCTTTTCACGTTGCGCGGCGTCTTGATGAGAGTCGCGGTATGGTTATCT
GA
 Primer design