SecReT4
Protein ID: 259909657
T4SS name [ID]Tfc [756]
Gene symbol-
Locus tagEpC_30320
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T4SS(s) in this replicon]
Location [Strand]3333640..3334074 [-]
Producthypothetical protein
Component typeTfc15
UniProt IDD0FVW7
KEGG IDepy:EpC_30320, epy:EpC_31940
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 144 a.a.     [Download]
>gi|259909657|ref|YP_002650013.1| hypothetical protein EpC_30320 [Erwinia pyrifoliae Ep1/96]
MGIMMYDNDNLRMRRHNLLVVMVLLLAGCSTSKDEMLPAGDSSMLELWNNGASSSHATTESRTTLRRPVA
DSERTLAQQTRDSYSRSQQNEIQQTFPRLPNPDMVMYVFPHLAGGNTPVPGYSTVFPFYGQVQYALPGER
TEDL
 
Nucleotide Sequence: 435 bp     [Download]
>gi|259906682|ref|NC_012214.1|:c3334074-3333640 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGGGGATAATGATGTACGACAACGATAATCTCAGGATGCGCAGGCATAACCTTCTGGTCGTCATGGTGC
TGTTGCTGGCGGGTTGCAGTACCTCTAAAGATGAGATGCTGCCCGCCGGCGACAGCTCGATGCTGGAGCT
GTGGAATAACGGCGCATCGTCCAGCCACGCCACGACGGAAAGCCGCACCACGCTGCGCAGGCCGGTTGCG
GACAGCGAGCGCACGCTGGCACAGCAGACGCGCGACAGTTACAGCCGCAGCCAGCAAAATGAAATCCAGC
AGACGTTTCCGCGCCTGCCTAACCCTGACATGGTGATGTACGTATTCCCGCACCTGGCGGGCGGTAACAC
GCCGGTGCCGGGCTACAGCACCGTGTTTCCCTTCTACGGGCAGGTGCAATATGCGCTGCCCGGCGAGCGC
ACCGAGGATCTCTGA
 Primer design