SecReT4
Protein ID: 259909658
T4SS name [ID]Tfc [756]
Gene symbol-
Locus tagEpC_30330
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T4SS(s) in this replicon]
Location [Strand]3334074..3335582 [-]
Producthypothetical protein
Component typeTfc14
UniProt IDD0FVW8
KEGG IDepy:EpC_30330
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 502 a.a.     [Download]
>gi|259909658|ref|YP_002650014.1| hypothetical protein EpC_30330 [Erwinia pyrifoliae Ep1/96]
MKAPSSNLLVKVAVPLVLTGAIVLGVKSCAESSSQTAGGQKTSNVALKDLTPEDLKALGIEGDTPQDTLR
TIVGNFRKVQERLDGIADDNKKLSDENKALKKTNGNVDRQISQVVDNARAEDTLKRSQLGAQVTDLSTQV
DRLMEQLRNGASGAAMVGKNSISGSDIPVGMGYDNGSGVNDSTPPADGMQWVEPKDGIPTDASGRPVSGS
NGNNATGFAFASTFDDVSDAGKTVNAATSAVQKTLSEAEKTTDPVYTLPENATLVGSQAMTALLGRVPVD
GKVTDPYPFKVMVGKDNLTANGIELPDVQGAIVSGTATGDWTLSCVRGAITSITFVFTDGTVPSPNGQNG
SGANQNGQGGNGNNSSIGWLSDDNGIPCISGTRKSNASTYLPTIAALAAAGAAGDALAQNQNTTQTNGYG
GVTSSLTGDAGQAVLGKAFSGGMRETVDWVKARYGQTFDAIYVPPGQKVALHITRQLAIDYEEKGRKVKY
DFSLAGSGTGMD
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|259906682|ref|NC_012214.1|:c3335582-3334074 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGAAAGCGCCATCTTCGAATCTGTTGGTGAAAGTAGCCGTTCCGCTGGTGCTGACCGGCGCTATCGTGC
TCGGCGTCAAATCCTGTGCTGAAAGCAGCAGCCAGACAGCCGGCGGGCAGAAAACCAGCAACGTGGCGCT
AAAGGATCTGACGCCGGAAGACCTGAAAGCGCTGGGCATTGAGGGAGATACGCCTCAGGACACGCTGCGC
ACCATCGTGGGTAATTTTCGCAAGGTACAGGAGCGTCTCGACGGGATTGCGGATGATAATAAAAAGCTCA
GCGATGAGAACAAGGCGCTGAAAAAAACCAACGGCAACGTGGATCGGCAGATAAGCCAGGTGGTGGACAA
TGCCCGTGCCGAAGATACGCTAAAGCGCTCACAGCTCGGCGCCCAGGTTACCGATCTGAGCACCCAGGTC
GACAGGCTGATGGAGCAGCTTCGAAACGGCGCTTCCGGCGCAGCAATGGTCGGTAAAAACAGCATTTCCG
GCAGTGATATCCCGGTCGGTATGGGTTATGACAACGGCTCTGGCGTGAACGACAGTACGCCACCGGCAGA
CGGCATGCAGTGGGTCGAGCCGAAAGACGGTATCCCGACCGACGCCAGTGGTCGTCCGGTGTCGGGCAGC
AACGGCAATAACGCCACCGGCTTTGCTTTTGCCAGCACCTTTGATGATGTCAGTGATGCCGGCAAGACGG
TTAATGCGGCGACCTCCGCCGTGCAGAAAACGTTGTCTGAAGCCGAAAAAACGACTGACCCTGTCTATAC
CCTGCCGGAGAACGCCACGCTGGTTGGCAGTCAGGCCATGACGGCGCTGCTGGGGCGCGTGCCGGTTGAC
GGCAAGGTGACCGATCCTTATCCCTTCAAGGTGATGGTCGGCAAAGACAACCTGACGGCCAACGGCATCG
AGCTGCCCGACGTGCAGGGAGCCATCGTATCGGGGACGGCGACCGGCGACTGGACGCTGTCCTGCGTACG
CGGTGCGATTACCAGTATCACCTTTGTCTTTACTGATGGCACCGTGCCGTCACCGAACGGGCAGAACGGC
AGCGGCGCTAATCAGAACGGCCAGGGCGGCAACGGCAATAACAGCAGCATCGGCTGGCTGTCGGACGACA
ACGGTATCCCCTGCATTTCCGGTACGCGTAAAAGCAACGCCTCCACCTATCTGCCGACCATCGCGGCGCT
TGCCGCCGCCGGCGCGGCCGGGGACGCGCTGGCGCAGAACCAGAATACCACCCAGACCAACGGCTACGGC
GGCGTCACCTCCAGCCTGACCGGCGATGCAGGCCAGGCCGTACTGGGTAAGGCGTTTTCCGGCGGCATGC
GTGAAACCGTTGACTGGGTTAAGGCGCGCTACGGCCAGACTTTCGACGCCATCTACGTACCACCCGGCCA
GAAGGTGGCGCTGCATATCACGCGCCAGCTGGCGATCGATTATGAAGAGAAGGGCCGCAAGGTGAAATAT
GACTTCAGCCTGGCCGGTAGCGGCACGGGCATGGACTGA
 Primer design