SecReT4
Protein ID: 259909659
T4SS name [ID]Tfc [756]
Gene symbol-
Locus tagEpC_30340
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T4SS(s) in this replicon]
Location [Strand]3335582..3336445 [-]
Producthypothetical protein
Component typeTfc13
UniProt IDD0FVW9
KEGG IDepy:EpC_30340, epy:EpC_31960
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 8.2e-110, Aligned region: 1..281
Protein Sequence: 287 a.a.     [Download]
>gi|259909659|ref|YP_002650015.1| hypothetical protein EpC_30340 [Erwinia pyrifoliae Ep1/96]
MKKITLILLALLLTSGAARAVELMKWERIPLQIPLTVGQERIVFVNKNVRVGFPSVLNNKLRIQSSGGVV
YLAASEAFAVTRLELQNKENGEIILLDVSAEPGKATREPVKIVCDGEVANASASDKQTVSGDGSARQPPS
DDAQASRKPAKLNAPLPVVLTRYAAQNMYGPLRTVEAVPGISPVSLKLPSAITTLMPSEAVSVTPMAAWS
LQGSSVIALQVRNRAADKVILDPRVLEGQFVTATFQHRWLGSSGTPEDTTVLYLVTAGRAESAFIAEPAV
KSSRRAK
 
Nucleotide Sequence: 864 bp     [Download]
>gi|259906682|ref|NC_012214.1|:c3336445-3335582 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
TTGAAAAAAATCACACTGATACTGCTGGCCCTGCTGCTGACGTCAGGCGCAGCACGGGCGGTAGAGCTGA
TGAAGTGGGAACGTATTCCACTACAGATCCCGTTAACGGTCGGTCAGGAGCGCATCGTCTTTGTGAACAA
AAATGTGCGCGTGGGCTTCCCGTCCGTCCTGAATAATAAGCTGCGTATTCAAAGCAGCGGTGGCGTGGTC
TATCTCGCCGCCAGCGAGGCGTTTGCGGTGACGCGCCTTGAGCTACAGAACAAGGAAAACGGTGAAATCA
TTCTGCTCGACGTCAGCGCTGAACCCGGCAAAGCCACGCGCGAGCCGGTAAAGATCGTCTGTGACGGTGA
GGTGGCTAACGCCAGCGCCAGTGATAAACAGACGGTCAGCGGCGACGGCAGCGCACGCCAGCCACCTTCG
GATGATGCGCAGGCCAGCCGTAAGCCGGCAAAGCTTAACGCCCCGCTGCCCGTGGTGCTGACCCGTTATG
CGGCGCAGAACATGTACGGCCCGCTGCGCACGGTGGAAGCGGTGCCGGGTATCAGCCCCGTCTCCCTGAA
GCTGCCGTCTGCCATCACCACGCTGATGCCGTCCGAAGCGGTGAGCGTGACGCCGATGGCGGCCTGGAGC
CTGCAGGGCAGTAGCGTTATTGCGCTGCAGGTGCGTAACCGCGCCGCTGACAAGGTTATTCTCGACCCGC
GCGTGCTGGAAGGGCAGTTTGTCACCGCCACCTTTCAGCACCGCTGGCTGGGCAGCTCTGGCACGCCGGA
GGACACCACGGTGCTGTATCTGGTGACGGCGGGCCGTGCGGAAAGCGCGTTTATTGCCGAACCGGCGGTT
AAAAGCAGCAGGAGAGCGAAATAA
 Primer design