SecReT4
Protein ID: 259909660
T4SS name [ID]Tfc [756]
Gene symbol-
Locus tagEpC_30350
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T4SS(s) in this replicon]
Location [Strand]3336442..3337101 [-]
Producthypothetical protein
Component typeTfc12
UniProt IDD0FVX0
KEGG IDepy:EpC_30350, epy:EpC_31970
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 1.3e-89, Aligned region: 8..203
Protein Sequence: 219 a.a.     [Download]
>gi|259909660|ref|YP_002650016.1| hypothetical protein EpC_30350 [Erwinia pyrifoliae Ep1/96]
MSRFRNGMTARDNPIFSLRIACVLLFSGLLFTSLGWMRAPSELTIHNPPDLRSGSTRKWWEVPPSTVYSF
AFYIFQQLNAWPKNGEMDYPAKIAQMSAYLTPSCQDFLNKDAEMRKNSDELRDRVRVVYEIPRRGYSSRS
VTIIGQDNWIVRLDLAADEYYHTEPVKRALVRYPLKVVRWEGDAERNPFGLALDCYAATPQRLEAMPLPE
AEKKSGAFN
 
Nucleotide Sequence: 660 bp     [Download]
>gi|259906682|ref|NC_012214.1|:c3337101-3336442 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGAGCCGTTTTCGCAACGGGATGACCGCGCGCGACAACCCTATTTTCTCGCTGCGCATCGCCTGCGTGC
TGCTGTTTAGCGGCCTGTTATTCACCAGTCTTGGCTGGATGCGCGCGCCGTCTGAGCTGACCATCCATAA
CCCGCCCGATCTGCGCTCCGGCAGTACCCGTAAATGGTGGGAGGTGCCGCCGTCAACGGTGTACAGCTTT
GCCTTTTATATCTTCCAGCAGCTCAACGCGTGGCCGAAAAATGGCGAGATGGACTACCCGGCGAAGATTG
CGCAGATGAGCGCCTACCTGACGCCGTCCTGCCAGGACTTTCTCAACAAAGACGCGGAGATGCGTAAGAA
CAGCGACGAGCTGCGCGACCGCGTGCGCGTGGTGTATGAAATCCCACGGCGCGGCTACAGCAGCCGCAGC
GTCACCATTATCGGCCAGGACAACTGGATCGTCCGGCTGGATCTGGCGGCCGACGAGTATTACCACACCG
AACCGGTGAAACGGGCGCTGGTGCGCTATCCGCTGAAGGTGGTGCGCTGGGAGGGCGATGCGGAGCGTAA
TCCTTTCGGCCTGGCGCTGGACTGCTATGCCGCCACGCCGCAACGGCTGGAGGCCATGCCGCTGCCGGAA
GCGGAGAAAAAGTCGGGAGCATTCAATTGA
 Primer design