SecReT4
Protein ID: 259909661
T4SS name [ID]Tfc [756]
Gene symbol-
Locus tagEpC_30360
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T4SS(s) in this replicon]
Location [Strand]3337098..3337472 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDD0FVX1
KEGG IDepy:EpC_30360, epy:EpC_31980
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 8.5e-33, Aligned region: 3..116
Protein Sequence: 124 a.a.     [Download]
>gi|259909661|ref|YP_002650017.1| hypothetical protein EpC_30360 [Erwinia pyrifoliae Ep1/96]
MAVIDFLPDRLNNPPVVWKGFTSGEFLLAAVTGILAGLPLAVPLSLVPFIGWLAFPTCMLLTPLVVVFLG
GGWIAGYKRGKPENYIWQRMEELRCRARLSRSMILDSRVWEMKRGAPVKRGGQV
 
Nucleotide Sequence: 375 bp     [Download]
>gi|259906682|ref|NC_012214.1|:c3337472-3337098 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGGCCGTCATCGACTTTCTTCCTGACAGACTGAACAACCCCCCTGTGGTGTGGAAAGGGTTCACCTCCG
GTGAGTTTTTGCTGGCGGCCGTTACCGGCATTCTGGCCGGCCTTCCGCTGGCCGTGCCGCTGTCGCTGGT
GCCGTTTATCGGCTGGCTGGCATTCCCCACCTGCATGCTGCTGACGCCGCTGGTTGTGGTGTTTCTCGGC
GGCGGCTGGATTGCCGGCTACAAGCGCGGCAAGCCGGAGAACTATATCTGGCAGCGCATGGAGGAGCTGC
GCTGCCGCGCCCGGCTGTCGCGCTCGATGATCCTCGACAGCCGCGTGTGGGAGATGAAACGCGGCGCGCC
GGTGAAGCGCGGAGGTCAGGTATGA
 Primer design