SecReT4
Protein ID: 259909662
T4SS name [ID]Tfc [756]
Gene symbol-
Locus tagEpC_30370
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T4SS(s) in this replicon]
Location [Strand]3337482..3337841 [-]
Producthypothetical protein
Component typeTfc10
UniProt IDD0FVX2
KEGG IDepy:EpC_30370, epy:EpC_31990
PDB IDNA
Domain hit(s) vs Pfam DUF2976 [PF11190], Evalue: 5.5e-26, Aligned region: 32..118
Protein Sequence: 119 a.a.     [Download]
>gi|259909662|ref|YP_002650018.1| hypothetical protein EpC_30370 [Erwinia pyrifoliae Ep1/96]
MKFVTLYRAALLRARLLLLPGLLWGGQVMADLPSVEQPTTGGGGGTYNTVMGYIKMGGLALGLLVCVAAF
LAVAHAVITSFHDIRRGKGSWTEFLLYLVVGIGLILLVIYLATKAADII
 
Nucleotide Sequence: 360 bp     [Download]
>gi|259906682|ref|NC_012214.1|:c3337841-3337482 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGAAATTCGTTACGCTATACCGTGCGGCGCTGCTACGTGCCAGGCTTCTGCTGCTGCCGGGGCTGCTCT
GGGGCGGGCAGGTCATGGCAGATCTGCCCTCTGTTGAACAGCCGACCACCGGCGGCGGTGGCGGCACCTA
TAACACCGTGATGGGCTACATCAAAATGGGCGGTCTGGCGCTCGGCCTGCTGGTCTGCGTGGCTGCTTTT
CTCGCCGTGGCTCACGCGGTGATCACTTCCTTCCATGATATCCGTCGCGGCAAGGGCTCCTGGACCGAGT
TTCTGCTCTATCTGGTGGTCGGTATCGGCCTCATCCTGCTGGTTATCTATCTGGCCACCAAAGCTGCCGA
CATCATTTAA
 Primer design