SecReT4
Protein ID: 259909664
T4SS name [ID]Tfc [756]
Gene symbol-
Locus tagEpC_30390
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T4SS(s) in this replicon]
Location [Strand]3338090..3338386 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDD0FVX4
KEGG IDepy:EpC_30390, epy:EpC_32010
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 2.4e-30, Aligned region: 12..90
Protein Sequence: 98 a.a.     [Download]
>gi|259909664|ref|YP_002650020.1| hypothetical protein EpC_30390 [Erwinia pyrifoliae Ep1/96]
MLLMMSAMSVMPCQASEKDELALVMRQLDQVQASLDRARVVANQNQDARFYFDYQQATRDITTIRQGIST
YLEPSRAQPSSRSAAVSGQYRGEEPSWR
 
Nucleotide Sequence: 297 bp     [Download]
>gi|259906682|ref|NC_012214.1|:c3338386-3338090 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
TTGCTGCTGATGATGTCAGCAATGTCTGTGATGCCGTGCCAGGCCTCTGAGAAAGACGAGCTGGCGCTGG
TCATGCGTCAGCTGGACCAGGTGCAGGCCAGCCTTGACCGCGCCCGCGTGGTGGCCAACCAGAATCAGGA
CGCCCGCTTTTATTTCGACTATCAGCAGGCGACACGCGATATCACCACCATCAGGCAGGGGATTTCCACT
TACCTCGAACCGTCACGCGCCCAGCCCTCATCTCGTTCTGCTGCGGTTAGCGGCCAGTACCGTGGCGAGG
AGCCGTCATGGCGATGA
 Primer design