SecReT4
Protein ID: 260585141
T4SS name [ID]VirB [396]
Gene symbol-
Locus tagCtu_2p00030
StrainCronobacter turicensis z3032
Repliconplasmid pCTU2 [GenBank: NC_013284] [Browse all T4SS(s) in this replicon]
Location [Strand]798..2468 [+]
Producthypothetical protein
Component typeVirD4
UniProt IDC9Y5N1
KEGG IDctu:Ctu_2p00030
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.8e-10, Aligned region: 316..513
TrwB_AAD_bind [PF10412], Evalue: 4.5e-10, Aligned region: 356..514
TraG-D_C [PF12696], Evalue: 1.7e-07, Aligned region: 377..474
AAA_10 [PF12846], Evalue: 5.5e-07, Aligned region: 353..455
Protein Sequence: 556 a.a.     [Download]
>gi|260585141|ref|YP_003212715.1| hypothetical protein Ctu_2p00030 [Cronobacter turicensis z3032]
MQDSPVILSILAGLTLPFIFHLPREERKNAPFWLKCVACASIFFFIFGTISPLTIQGLSYLFKVLDNNII
FKPVLWGLTIAFTFIGLLFHIMTRRLLAGEIDHLKHRMIKKSKLERNTRTDVREVKEMLPDSITYNPLDY
IDISKGVFIGLDKDDKPQYITVEEFQSQHADMIGTTGSGKGVSASVLLYQAILLDEGVFVEDPKNDEWAP
HVLREACRVAGKEFTLINLNDLNFQLDLLADINHEQLEELFNAGFSLAKKGEGADFYRIADRRAARKTSA
IYEKGMTLRDLFNTDFVKSLEEDVPAFYGELEEIALVNSINATYGFSLKKIFDEGGCCYIIGSMRNQKII
SAQRMILTRLIQIAETRDRIKEKPRPIAIFLDELKYHLSRPALEGLGAARDKGVHILMAHQSIKDLYDCP
ADLDGDAVAGSVVENCKFMLVYRLRDPDTAEWVARMTGSILVDDEMRKVTTDISLTEKIDTDRMIRQAER
YYIDSNMLLNLPKFVGFVFTQNDLAKATKLYHIPAKKKYIELLSFEDKSASPAFNESEQERPSIDL
 
Nucleotide Sequence: 1671 bp     [Download]
>gi|260585138|ref|NC_013284.1|:798-2468 Cronobacter turicensis z3032 plasmid pCTU2, complete sequence
CTGCAAGACAGCCCGGTAATACTCTCCATATTGGCGGGGCTAACGCTTCCTTTTATATTCCACCTGCCGA
GGGAGGAAAGAAAAAACGCACCCTTCTGGTTAAAGTGTGTGGCGTGCGCGTCTATCTTCTTCTTTATTTT
CGGAACAATATCACCACTTACCATACAGGGCTTGAGCTACCTGTTTAAAGTTCTCGATAACAACATTATC
TTTAAGCCGGTTCTGTGGGGGTTGACGATTGCATTCACCTTTATCGGTTTGCTTTTCCACATAATGACAC
GCAGATTACTGGCAGGGGAAATAGACCACCTTAAACACCGAATGATTAAAAAGAGCAAACTGGAAAGAAA
TACAAGAACAGACGTAAGGGAAGTGAAGGAAATGCTGCCTGACAGCATCACATATAATCCACTTGATTAT
ATCGACATTTCAAAAGGCGTATTCATTGGCTTAGATAAAGACGACAAGCCGCAATACATAACGGTTGAAG
AGTTTCAGTCTCAGCACGCAGATATGATAGGTACAACCGGTTCCGGTAAAGGTGTAAGCGCCTCTGTTCT
TCTTTATCAGGCAATCTTATTAGACGAAGGCGTCTTTGTTGAAGACCCGAAAAACGATGAATGGGCTCCG
CACGTTCTCCGTGAAGCCTGCCGAGTTGCCGGGAAAGAGTTCACACTGATAAACCTTAATGACCTTAATT
TCCAGCTAGACCTTTTAGCTGATATTAATCATGAGCAACTGGAAGAACTTTTTAACGCAGGCTTTAGCCT
GGCTAAAAAAGGAGAGGGTGCAGACTTTTATCGAATCGCTGACCGCAGGGCAGCAAGGAAAACATCCGCA
ATTTATGAAAAAGGAATGACACTCCGCGATTTATTTAACACCGACTTTGTTAAATCTCTGGAGGAAGATG
TCCCGGCATTCTATGGTGAACTAGAAGAGATAGCGCTGGTTAACTCAATTAATGCCACATACGGCTTCTC
TCTTAAAAAGATATTTGACGAGGGCGGCTGCTGCTACATTATTGGTTCGATGCGTAATCAGAAAATAATT
TCTGCTCAACGTATGATACTCACACGATTGATTCAGATCGCCGAGACACGAGACAGGATAAAAGAGAAGC
CCCGACCAATTGCCATTTTCCTTGATGAACTTAAATATCATCTCTCACGTCCTGCTCTGGAAGGTTTAGG
CGCAGCCAGGGATAAAGGCGTGCATATATTAATGGCGCACCAGTCAATTAAAGACCTTTACGATTGCCCC
GCAGATTTAGATGGTGATGCCGTTGCTGGTTCTGTGGTTGAAAACTGCAAATTCATGCTGGTTTATCGTC
TGCGCGATCCTGATACAGCAGAGTGGGTAGCAAGAATGACGGGCTCTATTCTTGTTGATGATGAAATGAG
AAAAGTCACAACTGATATATCTCTTACTGAGAAAATTGATACTGACAGGATGATAAGGCAGGCTGAAAGA
TACTATATCGATTCAAATATGCTGCTTAACCTTCCTAAATTCGTTGGTTTCGTTTTCACACAAAATGACC
TGGCAAAAGCCACCAAGCTTTACCATATACCAGCCAAGAAAAAGTATATCGAGCTTCTTTCCTTTGAGGA
TAAATCCGCATCGCCTGCCTTTAATGAAAGTGAGCAGGAAAGACCATCTATCGACTTGTGA
 Primer design