SecReT4
Protein ID: 260585164
T4SS name [ID]VirB [396]
Gene symbol-
Locus tagCtu_2p00260
StrainCronobacter turicensis z3032
Repliconplasmid pCTU2 [GenBank: NC_013284] [Browse all T4SS(s) in this replicon]
Location [Strand]17057..17740 [+]
Producthypothetical protein
Component typeVirB8
UniProt IDC9Y5Q4
KEGG IDctu:Ctu_2p00260
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.4e-51, Aligned region: 10..222
Protein Sequence: 227 a.a.     [Download]
>gi|260585164|ref|YP_003212738.1| hypothetical protein Ctu_2p00260 [Cronobacter turicensis z3032]
MSEQKLIAESRTFEQQMIDRDKRATKAGFIVGGVGLLIAVLALVAVVVMLPLKQTDVELYTVDNHTGRVE
HITRTSKTSLTAEEAYQKAMAANYVKIRERYVYPSLQDDYETVQMYNSPEVNNDYLALYAGKNAPDKVYN
NGANTVKIDILSSQITDGTAPDKVATIRYKKTIRRLVDNQTRYEYWDARFTFHSDPNKEMSDEEREVNYF
GFTVTSWQTDREIRGGE
 
Nucleotide Sequence: 684 bp     [Download]
>gi|260585138|ref|NC_013284.1|:17057-17740 Cronobacter turicensis z3032 plasmid pCTU2, complete sequence
ATGAGTGAACAGAAACTAATTGCTGAATCCCGCACCTTTGAGCAGCAAATGATTGACCGGGATAAACGCG
CCACAAAAGCCGGTTTTATTGTTGGCGGTGTGGGTCTGCTGATTGCGGTACTGGCGCTCGTCGCCGTGGT
CGTGATGTTGCCGCTGAAACAGACGGACGTCGAGCTGTATACCGTGGATAACCACACAGGACGGGTGGAA
CACATTACTCGGACATCAAAAACCAGCCTGACCGCAGAAGAAGCCTATCAAAAGGCGATGGCCGCAAACT
ACGTGAAAATCCGCGAGCGCTACGTCTATCCCTCCCTCCAGGACGATTACGAGACGGTTCAGATGTACAA
CAGCCCCGAGGTCAACAATGACTATCTGGCGTTGTATGCCGGTAAAAACGCCCCGGATAAGGTTTACAAC
AACGGGGCTAATACGGTGAAGATTGACATCCTGTCCAGTCAGATCACCGATGGCACGGCTCCCGATAAGG
TCGCCACTATCCGGTACAAAAAGACTATCCGCCGCCTTGTTGATAATCAGACCCGTTACGAGTACTGGGA
TGCGCGTTTTACGTTCCACTCTGACCCGAATAAAGAGATGAGCGACGAAGAGCGCGAGGTTAACTATTTC
GGCTTTACCGTCACGAGCTGGCAGACAGACCGTGAAATCCGAGGAGGTGAATGA
 Primer design