SecReT4
Protein ID: 260585167
T4SS name [ID]VirB [396]
Gene symbolvirB11
Locus tagCtu_2p00290
StrainCronobacter turicensis z3032
Repliconplasmid pCTU2 [GenBank: NC_013284] [Browse all T4SS(s) in this replicon]
Location [Strand]19989..21101 [+]
ProductType IV secretion system protein virB11
Component typeVirB11
UniProt IDC9Y5Q7
KEGG IDctu:Ctu_2p00290
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.3e-48, Aligned region: 18..201
T2SE [PF00437], Evalue: 1.3e-48, Aligned region: 207..308
Protein Sequence: 370 a.a.     [Download]
>gi|260585167|ref|YP_003212741.1| Type IV secretion system protein virB11 [Cronobacter turicensis z3032]
MTATNISLDRYKQRFFGDFLELPGLTEIAVNRPDELFTKIDGVWTQHAVSLSYDDCYNFARCLAKHHNDN
IEDIKPGLSATLESGERCQLVVPPACERGTVSATIRKPSRVQIPHQSYIDAGFYNRVTGSEQTETHDAEL
IELYNTKNIPLFMEKCVEYGKTIAVAGETSTGKTTYMKMLIGYIPLDLRITTIEDNPEITFFKHYMKMLI
GYIPLDLRITTIEDNPEITFFKHKNYVHLFYPSESSDEKGSIVTPASLLRWNYRMNPDRILLTEVRGAEA
WDFLKITGSGHEGSMTSIHAGSAMEAIDGFITRCYENPQCAQLPYAFMLRKVLDSLDVIVSIDLDGNIRR
MNDIYFRPVHRKEYFEAMKS
 
Nucleotide Sequence: 1113 bp     [Download]
>gi|260585138|ref|NC_013284.1|:19989-21101 Cronobacter turicensis z3032 plasmid pCTU2, complete sequence
ATGACGGCTACTAACATCTCTCTAGACCGCTATAAGCAACGGTTTTTTGGTGATTTCCTTGAACTCCCCG
GACTTACAGAAATTGCTGTAAACCGTCCTGATGAGCTGTTTACTAAAATTGATGGCGTGTGGACACAGCA
CGCCGTTTCTCTCAGCTATGACGACTGCTATAACTTTGCCCGCTGCCTGGCAAAGCATCACAACGACAAC
ATAGAGGACATCAAGCCGGGGCTGTCGGCCACGCTGGAATCTGGCGAACGCTGCCAGTTGGTTGTACCTC
CGGCATGTGAGCGCGGCACGGTCTCTGCCACAATCCGAAAACCTTCGAGGGTACAAATCCCGCACCAGTC
ATACATTGATGCGGGATTTTATAATCGTGTTACGGGCTCTGAACAAACCGAAACGCACGATGCCGAACTA
ATTGAATTGTACAATACAAAAAACATTCCGCTCTTTATGGAAAAGTGCGTTGAATACGGGAAAACCATTG
CGGTTGCAGGTGAAACGAGCACGGGGAAAACAACCTATATGAAAATGCTGATAGGTTATATCCCGCTTGA
CCTCAGGATCACAACCATTGAGGACAACCCCGAAATTACGTTCTTTAAACACTATATGAAAATGCTGATA
GGTTATATCCCGCTTGACCTCAGGATCACAACCATTGAGGACAACCCCGAAATTACGTTCTTTAAACATA
AAAACTATGTGCATCTTTTTTATCCGTCTGAGTCATCAGACGAAAAAGGCTCGATTGTTACGCCAGCGAG
TCTTTTGCGCTGGAATTACCGTATGAACCCCGACCGCATTTTATTAACAGAGGTCAGGGGAGCCGAAGCC
TGGGACTTCCTGAAAATAACAGGTTCAGGGCATGAAGGGAGTATGACGTCTATTCATGCCGGTTCGGCAA
TGGAAGCCATCGACGGTTTTATTACGCGCTGCTATGAAAACCCACAATGCGCACAACTTCCCTATGCCTT
TATGTTACGTAAGGTGCTGGATAGCCTGGACGTTATTGTGAGTATCGATCTGGACGGCAATATCCGCCGA
ATGAATGATATTTATTTCCGTCCTGTACATCGAAAAGAATATTTCGAGGCCATGAAATCATGA
 Primer design