SecReT4
Protein ID: 260685147
T4SS name [ID]Tra_Tn [674]
Gene symbol-
Locus tagCD196_3418
StrainClostridium difficile CD196
Repliconchromosome [GenBank: NC_013315] [Browse all T4SS(s) in this replicon]
Location [Strand]4030527..4032959 [+]
Productconjugative transposon protein
Component typeOrf16_Tn
UniProt IDC9XSN1
KEGG IDcdc:CD196_3418
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.2e-33, Aligned region: 472..756
Protein Sequence: 810 a.a.     [Download]
>gi|260685147|ref|YP_003216432.1| conjugative transposon protein [Clostridium difficile CD196]
MFPIKYIDNNLVWNKDNEVFAYYELIPYNYSFLSAEQKFIVHDSFRQLIAQSREGKIHALQIATESSSRS
IQEQSKKLVTGRLKDVAYQKIDEQTEALVSMIGDNQVDYRFFLGFKLMVTDQSMNLKSVKQSAFLTFKEF
IHEVNHTLMNDFVSMPNDEINRYMKMEKLLENKISRRFKVRRLDKNDFGYLIEHIYGRDGVAYEDYEYSL
PKKKLKKETLITHYDLIRPTRCLVEESQRHLRLEHEDSESYVSYFTVNAIVGELDFPSSEIFYFQQQQFT
FPVDTSMNVEIVENRKALSTVRNKKKELKDLDNHAYQSGSETSSNVVDALDSVDELETDLDQSRESMYKL
SYVIRVSAPDLDELKRRCDEVKDFYDDLNVKLVRPAGDMLGLHSEFLPASKRYINDYVQYVKSDFLAGLG
FGATQQLGENTGIYIGYSVDTGRNVYLQPSLASQGVKDTVTNALASAFVESLGGGKSFCNNLLVYYSVLF
GGQAVILDPKSERGNWKETLPEIAHEINIVNLTSDRENAGLLDPFVIMQNVKDAESLAIDILTFLTGISS
RDGEKFPVLRKAVRAVTQSDQRGLLHVIEELRKEDTPISCNIADHIDSFTDYDFAHLLFSDGTVQNAISL
DNQLNIIQVADLVLPDKDTTFELLSVSMLIVISTFALDFIHSDRSVFKIVDLDEAWAFLNVAQGETLSNK
LVRAGRAMNAGVYFVTQSSGDVSKESLKNNIGLKFAFRSTDINEIKQTLEFFSIDKEDENNQKRLRDLEN
GQCLLQDLYGRVGVVQIHPVFEELLHAFDTRPPIQRNEVE
 
Nucleotide Sequence: 2433 bp     [Download]
>gi|260681769|ref|NC_013315.1|:4030527-4032959 Clostridium difficile CD196 chromosome, complete genome
ATGTTCCCGATTAAATATATCGACAACAACCTTGTCTGGAACAAGGACAATGAGGTGTTCGCCTACTATG
AGCTGATACCTTACAATTACAGTTTTCTATCCGCTGAACAGAAATTCATTGTGCATGACAGCTTCCGACA
GCTAATCGCACAATCCCGTGAGGGCAAGATACACGCTTTGCAGATTGCCACAGAAAGCTCAAGCCGAAGC
ATACAAGAACAGTCAAAGAAGCTGGTTACGGGACGACTAAAAGACGTTGCCTATCAGAAGATAGACGAAC
AGACCGAAGCGTTAGTATCTATGATTGGGGACAATCAAGTGGACTACCGCTTTTTTCTTGGCTTCAAGCT
CATGGTAACAGACCAGAGCATGAACCTAAAGAGCGTGAAGCAATCGGCGTTTCTCACATTCAAGGAGTTT
ATCCATGAAGTGAACCACACGCTGATGAATGACTTTGTTTCCATGCCAAATGATGAAATCAACCGCTACA
TGAAAATGGAAAAGCTGTTGGAAAATAAAATAAGCCGACGCTTCAAAGTAAGACGCTTAGATAAAAATGA
CTTCGGCTATCTGATTGAACACATCTACGGCAGGGACGGTGTCGCCTATGAAGATTATGAGTATAGCTTA
CCGAAGAAGAAACTGAAAAAGGAAACGCTGATAACGCATTATGACTTGATACGTCCGACCCGTTGCCTTG
TGGAAGAAAGCCAGCGACATTTACGCTTGGAACATGAGGACAGCGAAAGCTACGTTTCCTACTTTACTGT
CAATGCGATTGTCGGCGAGCTTGATTTTCCGTCCAGTGAAATCTTCTATTTCCAGCAACAGCAGTTTACT
TTTCCCGTTGATACCAGCATGAATGTAGAAATCGTGGAAAACCGAAAAGCGTTATCGACGGTTCGCAACA
AGAAAAAAGAGCTGAAAGATTTAGACAATCATGCATACCAGTCTGGCAGTGAAACCAGCTCAAATGTGGT
AGACGCATTAGACAGTGTGGACGAGCTGGAAACGGATTTAGACCAGTCCAGAGAAAGTATGTATAAGCTC
TCTTATGTTATCCGTGTATCTGCTCCAGACCTTGACGAGTTGAAAAGACGCTGTGATGAAGTCAAAGACT
TCTACGACGATTTGAACGTCAAGCTGGTACGCCCTGCTGGCGATATGCTGGGGCTTCACTCTGAATTTCT
TCCTGCCAGCAAGCGATACATCAACGATTATGTGCAGTATGTCAAAAGTGATTTTCTAGCTGGGCTGGGC
TTTGGTGCGACACAGCAGTTAGGGGAAAACACGGGTATCTATATCGGCTATTCTGTCGATACGGGACGCA
ATGTTTATCTACAACCGTCCCTTGCCAGTCAAGGCGTAAAAGATACGGTTACTAATGCTCTTGCTTCTGC
CTTTGTAGAAAGTCTTGGCGGTGGAAAATCATTCTGTAACAACCTGCTTGTCTACTACTCTGTGCTGTTT
GGCGGTCAAGCGGTAATCTTAGACCCAAAATCCGAGCGTGGCAACTGGAAAGAAACGCTCCCAGAAATCG
CCCATGAAATCAATATCGTGAACCTTACCAGCGACAGAGAAAATGCAGGGCTTCTTGACCCGTTCGTGAT
TATGCAGAATGTGAAAGACGCTGAAAGTCTGGCAATCGACATACTCACATTCCTTACGGGCATTTCTTCA
AGGGACGGCGAGAAGTTCCCCGTACTTAGAAAGGCAGTGCGTGCCGTTACCCAGAGCGACCAGCGAGGAT
TGCTCCATGTGATTGAGGAATTAAGAAAAGAAGATACACCTATCTCTTGCAATATTGCCGACCATATCGA
CAGCTTCACGGACTACGACTTTGCACATCTGCTGTTCTCGGACGGTACGGTGCAAAATGCAATCAGCTTA
GACAACCAGCTCAATATCATTCAAGTAGCCGACTTAGTGCTACCCGATAAGGACACGACCTTTGAATTAC
TGTCCGTTTCCATGCTGATTGTGATTAGTACCTTTGCGTTAGATTTTATCCACTCGGATAGAAGTGTTTT
CAAGATTGTAGACCTTGACGAAGCATGGGCGTTCTTAAATGTGGCACAAGGCGAAACGCTCTCTAACAAG
CTGGTTCGTGCTGGACGTGCCATGAACGCAGGCGTTTATTTTGTTACACAGTCCTCTGGCGACGTGTCAA
AGGAAAGTCTGAAAAACAATATCGGTTTGAAATTTGCCTTTAGAAGCACCGATATTAACGAAATAAAACA
GACCCTTGAATTTTTCAGCATTGACAAAGAGGACGAGAACAACCAGAAGCGATTGCGTGATTTGGAAAAC
GGGCAATGCTTGCTTCAAGATTTATACGGACGTGTGGGCGTGGTGCAGATACACCCAGTCTTTGAAGAAT
TACTGCACGCCTTTGATACCAGACCGCCGATACAGCGAAATGAGGTGGAGTGA
 Primer design