SecReT4
Protein ID: 260688799
T4SS name [ID]Tra_Tn [673]
Gene symbol-
Locus tagCDR20291_3458
StrainClostridium difficile R20291
Repliconchromosome [GenBank: NC_013316] [Browse all T4SS(s) in this replicon]
Location [Strand]4105406..4106800 [+]
Productconjugative transposon FtsK_SpoIIIE-related protein
Component typeOrf21_Tn
UniProt IDC9YS90
KEGG IDcdl:CDR20291_3458
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 1.3e-31, Aligned region: 191..368
AAA_10 [PF12846], Evalue: 1.3e-06, Aligned region: 225..262
Protein Sequence: 464 a.a.     [Download]
>gi|260688799|ref|YP_003219933.1| conjugative transposon FtsK_SpoIIIE-related protein [Clostridium difficile R20291]
MRMILNKGHRIRARDKNLVYHFSIGTLLFVFVAVLLLLNIKQLMRTDWEHFSLLDNGLTLSPYNFITILI
ATGICALVAFLYYRFCYDSFKKLLHRQKLARMILENKWYEADTVQDSGFFTDLQSRSREKIVWFPKIYYQ
MENGLLHIHCEITLGKYQDQLLRLEDKLESGLYCELTDKTLHDGYIEYTLLYDMIANRISIDEVKAENGC
LRLMKNLVWEYDVLPHALIAGGTGGGKTYFLLTLIEALLHTNAVLYILDPKNADLADLGTVMGNVYHTKE
DMIDCVNAFYEGMVQRSEEMKQHPDYKTGENYAYLGLPPCFLIFDEYVAFFEMLGTKESVSLLSQLKKIV
MLGRQAGYFLIVACQRPDAKYFSDGIRDNFNFRVGLGRISELGYGMLFGSDVKKQFFQKRIKGRGYCDVG
TSVISEFYTPLVPKGHDFLQTIGSLAFVRQDGTATCEAKGDGTD
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|260685375|ref|NC_013316.1|:4105406-4106800 Clostridium difficile R20291 chromosome, complete genome
ATGCGAATGATTTTGAATAAAGGACACCGTATCAGAGCCAGAGACAAGAACCTTGTCTACCACTTTTCCA
TAGGGACGCTTCTGTTTGTATTTGTGGCGGTTCTCCTGCTACTGAATATCAAACAGCTCATGCGTACCGA
CTGGGAACATTTCAGCTTATTGGACAATGGCTTGACGCTTTCCCCCTACAACTTCATAACCATATTGATA
GCGACTGGTATTTGTGCATTGGTCGCTTTTCTGTATTACCGCTTCTGTTATGACAGTTTCAAAAAGCTCC
TGCACCGTCAAAAGCTGGCACGAATGATACTGGAAAACAAGTGGTATGAAGCAGATACCGTACAAGACAG
CGGTTTTTTTACTGACCTGCAAAGCAGATCAAGGGAAAAAATCGTCTGGTTTCCAAAGATTTATTATCAA
ATGGAAAACGGATTGCTTCATATTCACTGTGAAATCACATTAGGAAAATATCAAGACCAGCTTTTGCGAT
TAGAGGATAAGCTGGAAAGCGGTTTGTACTGTGAGCTGACCGACAAGACCTTGCATGACGGCTATATTGA
GTACACGCTTTTATATGACATGATAGCGAACCGTATTTCCATTGACGAAGTGAAAGCAGAAAACGGCTGT
CTTAGGCTGATGAAAAATCTTGTCTGGGAATATGACGTACTCCCTCACGCTCTGATAGCTGGTGGGACTG
GTGGCGGTAAGACCTACTTTCTGCTGACGCTTATTGAAGCTCTGCTACATACGAATGCTGTCCTTTACAT
CTTAGACCCAAAGAACGCTGACCTTGCAGACTTAGGTACAGTTATGGGAAATGTGTATCATACCAAAGAA
GATATGATTGATTGTGTCAATGCCTTTTATGAGGGCATGGTACAAAGAAGCGAAGAAATGAAGCAACACC
CAGACTATAAAACGGGCGAAAACTACGCCTATCTTGGTTTACCGCCCTGCTTTCTTATCTTTGATGAATA
TGTGGCGTTTTTTGAAATGCTGGGGACAAAGGAAAGCGTAAGTTTACTTAGCCAGTTAAAGAAAATCGTT
ATGTTGGGACGACAAGCTGGATATTTCCTTATTGTTGCCTGCCAGCGTCCAGACGCAAAATATTTCTCGG
ACGGTATCAGAGATAATTTCAATTTCCGTGTTGGATTGGGGCGTATCAGCGAATTGGGTTACGGTATGCT
CTTTGGTTCTGATGTGAAAAAACAGTTTTTCCAGAAGCGTATCAAGGGGCGTGGCTATTGTGATGTGGGA
ACAAGTGTCATAAGTGAGTTTTACACGCCTTTAGTCCCGAAAGGACATGATTTTTTGCAGACCATAGGCT
CTCTTGCATTCGTAAGGCAGGACGGGACGGCGACGTGCGAAGCGAAAGGCGACGGCACGGACTAG
 Primer design