SecReT4
Protein ID: 260688807
T4SS name [ID]Tra_Tn [673]
Gene symbol-
Locus tagCDR20291_3466
StrainClostridium difficile R20291
Repliconchromosome [GenBank: NC_013316] [Browse all T4SS(s) in this replicon]
Location [Strand]4115877..4116884 [+]
Productcell wall hydrolase
Component typeOrf14_Tn
UniProt IDC9YS98
KEGG IDcdl:CDR20291_3466
PDB IDNA
Domain hit(s) vs Pfam Lysozyme_like [PF13702], Evalue: 1.4e-58, Aligned region: 47..204
NLPC_P60 [PF00877], Evalue: 9.7e-31, Aligned region: 226..331
DUF1175 [PF06672], Evalue: 1.9e-05, Aligned region: 273..311
Protein Sequence: 335 a.a.     [Download]
>gi|260688807|ref|YP_003219941.1| cell wall hydrolase [Clostridium difficile R20291]
MKLRHIAIVGSLFSILFSLVLFFGVLISAEDDDGGNGYSSNYVGMNLSAEVLKHQPMVEKYAKENGISEY
VNVLLVIIQVESGGTAEDVMQSSESLGLPPNSLDTESSIKQGCKYFASLLSSCKNQGISDINVVIQSYNY
GGGYVGYVAGNGKKHMFNLAENFARDKSGGQKVTYTNPIAVAKNGGWRYGYGNMFYVELVNQYLVVNQVS
GELAQKVMNEALKYQGWKYVYGGSNPNTSFDCSGLVQWCYNKAGVSLPRTAQNQYDATQHIPLSQAKAGD
LVFFHSTYNAGSYVTHVGIYVGNTQMYHAGDPIGYADLNNAYWQQYLICAGRIKQ
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|260685375|ref|NC_013316.1|:4115877-4116884 Clostridium difficile R20291 chromosome, complete genome
ATGAAACTAAGACATATCGCTATTGTTGGCAGTCTGTTTTCTATCCTCTTTTCTCTCGTATTATTCTTTG
GGGTTCTGATTAGTGCCGAGGACGACGACGGGGGCAATGGTTATTCCTCTAATTATGTAGGTATGAACCT
ATCTGCCGAAGTCTTGAAACATCAGCCTATGGTAGAAAAGTATGCCAAAGAAAACGGTATTTCCGAGTAT
GTCAATGTGTTGCTGGTAATCATACAAGTGGAAAGTGGCGGTACAGCCGAGGACGTTATGCAAAGCTCTG
AAAGTCTGGGACTACCACCCAACTCACTAGATACGGAAAGCTCAATCAAGCAGGGGTGTAAATATTTTGC
GTCCCTGCTTTCTTCCTGCAAAAATCAAGGTATCAGTGATATAAATGTTGTGATACAGTCCTATAACTAT
GGCGGTGGCTATGTTGGCTATGTGGCAGGAAACGGAAAAAAGCATATGTTCAACCTTGCGGAAAACTTCG
CAAGGGATAAGTCGGGCGGTCAAAAAGTAACCTATACGAACCCTATCGCCGTGGCAAAAAATGGTGGCTG
GCGTTATGGCTATGGAAATATGTTCTATGTGGAGCTTGTGAACCAGTACCTTGTTGTCAATCAAGTATCG
GGCGAGCTGGCACAAAAGGTTATGAATGAAGCCTTAAAATATCAAGGTTGGAAGTATGTATATGGTGGCA
GTAACCCGAACACTTCTTTTGATTGTTCGGGACTGGTACAGTGGTGCTACAACAAAGCTGGCGTATCTTT
ACCGAGAACCGCACAAAATCAGTATGACGCAACCCAGCATATCCCACTATCGCAGGCAAAGGCAGGCGAT
TTGGTCTTTTTCCACAGTACCTACAATGCAGGAAGCTATGTAACCCACGTCGGTATCTATGTAGGAAACA
CTCAGATGTATCATGCAGGCGACCCTATCGGATATGCCGATTTAAACAATGCTTATTGGCAACAGTACTT
GATTTGTGCTGGAAGAATAAAACAGTAG
 Primer design