SecReT4
Protein ID: 260688808
T4SS name [ID]Tra_Tn [673]
Gene symbol-
Locus tagCDR20291_3467
StrainClostridium difficile R20291
Repliconchromosome [GenBank: NC_013316] [Browse all T4SS(s) in this replicon]
Location [Strand]4116900..4117793 [+]
Productconjugative transposon protein
Component typeOrf13_Tn
UniProt IDC9YS99
KEGG IDcdl:CDR20291_3467
PDB IDNA
Domain hit(s) vs Pfam TpcC [PF12642], Evalue: 2.2e-58, Aligned region: 71..295
Protein Sequence: 297 a.a.     [Download]
>gi|260688808|ref|YP_003219942.1| conjugative transposon protein [Clostridium difficile R20291]
MFKKKEKPVKETKVRTMKVGTHKKSVIALWVVLIASVSFGVYKNFTAIDMHTVHETETIQLRLNDTNGVE
NFVKNFCKSYYTWDNSKEAIEARTQAISNYLTKELQDLNLDTIRTDIPTSSTVTNVLIWDIKQSGTNDFI
ATYEVDQQIKEGEQTSNVKATYTVKVHVDKDGDMVIVQNPTIAPAIEKSDYEPKAQEADASVDADTVNDA
TAFLETFFKLYPTATEKELAYYVAGNVLEPIGRDYLYSELVNPMFTDDRDNVKVRVAVKFIDNQTKAMQV
SQFELVLHKDSNWKIIM
 
Nucleotide Sequence: 894 bp     [Download]
>gi|260685375|ref|NC_013316.1|:4116900-4117793 Clostridium difficile R20291 chromosome, complete genome
ATGTTTAAAAAGAAAGAAAAACCAGTAAAAGAAACGAAAGTCCGCACTATGAAAGTAGGCACACATAAGA
AATCTGTGATTGCTCTGTGGGTGGTGCTTATCGCCAGCGTATCATTTGGCGTGTATAAGAACTTTACCGC
CATTGATATGCACACGGTACATGAAACGGAAACCATTCAGTTAAGACTAAATGACACCAACGGAGTTGAA
AATTTTGTGAAGAACTTCTGTAAGTCCTACTACACATGGGACAACAGCAAGGAAGCTATCGAAGCAAGGA
CGCAGGCAATCAGCAACTATCTGACAAAGGAGTTGCAGGACTTGAACCTTGATACCATTAGGACGGATAT
ACCGACAAGCTCCACTGTTACAAATGTACTGATTTGGGATATAAAACAGTCTGGAACGAACGATTTTATC
GCTACCTACGAAGTAGATCAGCAGATAAAAGAGGGAGAACAGACAAGCAATGTCAAAGCAACCTATACCG
TCAAAGTCCATGTGGATAAAGACGGCGATATGGTTATCGTACAGAACCCAACCATTGCACCAGCGATTGA
AAAATCAGACTATGAGCCAAAGGCACAAGAAGCCGACGCAAGCGTGGACGCAGATACCGTCAATGACGCT
ACCGCATTTTTGGAAACTTTCTTTAAGCTGTATCCGACAGCAACAGAAAAAGAACTTGCCTACTATGTGG
CTGGCAATGTGCTTGAACCTATCGGCAGGGACTACCTCTATTCCGAATTAGTCAATCCTATGTTTACGGA
TGACAGGGATAATGTGAAAGTCAGGGTTGCGGTGAAATTCATTGATAATCAGACAAAGGCAATGCAGGTA
TCACAGTTTGAGCTTGTGTTACATAAGGATAGCAACTGGAAAATTATTATGTAA
 Primer design