SecReT4
Protein ID: 260751881
T4SS name [ID]Tra_F [533]
Gene symbol-
Locus tagECO111_p3-58
StrainEscherichia coli O111:H- str. 11128
Repliconplasmid pO111_3 [GenBank: NC_013366] [Browse all T4SS(s) in this replicon]
Location [Strand]43755..44138 [+]
Productconjugal transfer protein TraM
Component typeTraM_F
UniProt IDC8URG3
KEGG IDeoi:ECO111_p3-58
PDB IDNA
Domain hit(s) vs Pfam Tra_M [PF05261], Evalue: 1e-59, Aligned region: 1..127
Protein Sequence: 127 a.a.     [Download]
>gi|260751881|ref|YP_003237795.1| mating signal protein TraM [Escherichia coli O111:H- str. 11128]
MAKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQMERKESAFNQTEFNKLL
LECVVKTQSSVAKILGIESLSPHVSGNPKFEYANMVEDIREKVSSEMERFFPKNDDE
 
Nucleotide Sequence: 384 bp     [Download]
>gi|260751835|ref|NC_013366.1|:43755-44138 Escherichia coli O111:H- str. 11128 plasmid pO111_3, complete sequence
ATGGCTAAGGTGAACCTGTATATCAGCAATGATGCCTATGAAAAAATAAATGCGATTATTGAGAAGCGTC
GACAGGAAGGGGCAAGGGAAAAAGATGTCAGTTTTTCAGCAACAGCTTCAATGCTTCTTGAACTGGGGCT
TCGTGTACATGAGGCTCAGATGGAGCGTAAAGAGTCTGCATTTAATCAGACTGAGTTTAATAAATTGCTT
CTTGAATGCGTTGTAAAAACACAATCATCAGTAGCGAAAATTTTGGGTATTGAGTCTCTCAGTCCTCATG
TCTCCGGAAATCCAAAGTTTGAATATGCCAATATGGTTGAAGATATCAGGGAGAAGGTATCATCTGAGAT
GGAACGATTTTTTCCAAAAAATGATGATGAATAA
 Primer design