SecReT4
Protein ID: 260751883
T4SS name [ID]Tra_F [533]
Gene symbol-
Locus tagECO111_p3-60
StrainEscherichia coli O111:H- str. 11128
Repliconplasmid pO111_3 [GenBank: NC_013366] [Browse all T4SS(s) in this replicon]
Location [Strand]45113..45508 [+]
Productconjugal transfer protein TraY
Component typeTraY_F
UniProt IDC8URG5
KEGG IDeoi:ECO111_p3-60
PDB IDNA
Domain hit(s) vs Pfam TraY [PF05509], Evalue: 4.4e-38, Aligned region: 15..58
TraY [PF05509], Evalue: 4.4e-38, Aligned region: 70..117
Protein Sequence: 131 a.a.     [Download]
>gi|260751883|ref|YP_003237797.1| conjugal transfer protein Y TraY [Escherichia coli O111:H- str. 11128]
MKRFGTRSATGKMVKLKLPVDVESLLIEASNRSGRSRSFEAVIRLKDHLHRYPKFNRAGNIYGKSLVKYL
TMRLDDETNQLLIAAKNRSGWCKTDEAADRVIDHLIKFPDFYNSEIFREADKEEDITFNTL
 
Nucleotide Sequence: 396 bp     [Download]
>gi|260751835|ref|NC_013366.1|:45113-45508 Escherichia coli O111:H- str. 11128 plasmid pO111_3, complete sequence
TTGAAAAGATTTGGTACACGTTCTGCAACAGGTAAGATGGTAAAACTAAAATTACCTGTAGATGTGGAAA
GTCTATTAATTGAGGCAAGTAACAGAAGCGGAAGAAGTCGATCGTTTGAGGCAGTAATAAGACTTAAAGA
TCATCTTCACCGCTATCCAAAGTTTAACAGGGCAGGGAATATCTATGGTAAGTCGCTGGTTAAGTATCTG
ACAATGCGTCTGGATGATGAAACTAACCAGCTACTTATTGCAGCCAAAAATCGTAGTGGATGGTGTAAAA
CAGATGAGGCTGCAGACAGAGTTATTGATCATTTGATCAAGTTTCCTGATTTTTATAACTCGGAGATATT
CAGGGAGGCAGATAAAGAGGAAGATATAACATTTAATACACTCTAG
 Primer design