SecReT4
Protein ID: 260751884
T4SS name [ID]Tra_F [533]
Gene symbol-
Locus tagECO111_p3-61
StrainEscherichia coli O111:H- str. 11128
Repliconplasmid pO111_3 [GenBank: NC_013366] [Browse all T4SS(s) in this replicon]
Location [Strand]45541..45900 [+]
Productconjugal transfer pilin subunit TraA
Component typeTraA_F
UniProt IDC8URG6
KEGG IDeoi:ECO111_p3-61
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 1.2e-61, Aligned region: 1..118
Protein Sequence: 119 a.a.     [Download]
>gi|260751884|ref|YP_003237798.1| fimbrial subunit TraA [Escherichia coli O111:H- str. 11128]
MNAVLSVQGASAPVKKKSFFSKFTRLNMLRLARAVIPAAVLMMFFPQLAMAAQGQDLMASGNTTVKATFG
KDSSVVKWVVLAEVLVGAVMYMMTKNVKFLAGFAIISVFIAVGMAVVGL
 
Nucleotide Sequence: 360 bp     [Download]
>gi|260751835|ref|NC_013366.1|:45541-45900 Escherichia coli O111:H- str. 11128 plasmid pO111_3, complete sequence
ATGAATGCTGTTTTAAGTGTTCAGGGTGCTTCTGCGCCCGTCAAAAAGAAGTCGTTTTTTTCTAAATTCA
CTCGTCTGAATATGCTTCGCCTGGCTCGCGCTGTGATCCCGGCTGCTGTTCTGATGATGTTCTTCCCGCA
ACTGGCAATGGCAGCACAGGGCCAGGACCTGATGGCAAGCGGTAACACCACGGTTAAGGCGACCTTCGGT
AAGGACTCCAGTGTTGTTAAATGGGTCGTTCTGGCTGAAGTTCTGGTCGGTGCTGTCATGTACATGATGA
CCAAAAACGTCAAGTTCCTGGCCGGTTTTGCCATCATCTCTGTATTTATTGCTGTGGGTATGGCCGTCGT
TGGCCTCTGA
 Primer design