SecReT4
Protein ID: 260751885
T4SS name [ID]Tra_F [533]
Gene symbol-
Locus tagECO111_p3-62
StrainEscherichia coli O111:H- str. 11128
Repliconplasmid pO111_3 [GenBank: NC_013366] [Browse all T4SS(s) in this replicon]
Location [Strand]45915..46226 [+]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDC8URG7
KEGG IDeoi:ECO111_p3-62
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.3e-36, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|260751885|ref|YP_003237799.1| pilus assembly and synthesis protein TraL [Escherichia coli O111:H- str. 11128]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGITTSKYLFGIGAAVLVFFGIKKLKKGRGS
SWLRDLIYWYMPTALLCGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|260751835|ref|NC_013366.1|:45915-46226 Escherichia coli O111:H- str. 11128 plasmid pO111_3, complete sequence
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTATTGGCTGGGGTATCACAACATCGAAATA
TCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTTTTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGTGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design