SecReT4
Protein ID: 260751887
T4SS name [ID]Tra_F [533]
Gene symbol-
Locus tagECO111_p3-64
StrainEscherichia coli O111:H- str. 11128
Repliconplasmid pO111_3 [GenBank: NC_013366] [Browse all T4SS(s) in this replicon]
Location [Strand]46801..47529 [+]
Productconjugal transfer protein TraK
Component typeTraK_F
UniProt IDC8URG9
KEGG IDeoi:ECO111_p3-64
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 4.3e-70, Aligned region: 12..235
Protein Sequence: 242 a.a.     [Download]
>gi|260751887|ref|YP_003237801.1| lipoprotein TraK [Escherichia coli O111:H- str. 11128]
MRKNNTAIIFGSLFFSCSVMAANGTLAPTVVPMVNGGQASIAISNTSPNLFTVPGDRIIAVNSLDGALTN
NEQTASGGVVVATVNKKPFTFILETERGLNLSIQAVPREGAGRTIQLVSDLRGTGEEAGAWETSTPYESL
LVTISQAVRGGKLPAGWYQVPVTKETLQAPAGLSSVADAVWTGNHLKMVRFAVENKTLSALNIRESDFWQ
PGTRAVMFSQPASQLLAGARMDVYVIRDGEGN
 
Nucleotide Sequence: 729 bp     [Download]
>gi|260751835|ref|NC_013366.1|:46801-47529 Escherichia coli O111:H- str. 11128 plasmid pO111_3, complete sequence
ATGAGAAAAAATAATACGGCAATAATATTCGGCAGCCTGTTTTTTTCCTGCAGCGTGATGGCCGCAAACG
GTACGCTGGCCCCCACCGTGGTGCCAATGGTGAACGGTGGTCAGGCCAGTATTGCCATCAGCAATACCAG
CCCGAATCTGTTTACCGTTCCCGGTGACCGGATTATCGCCGTGAACAGTCTGGATGGTGCCCTGACCAAT
AATGAGCAGACCGCCTCCGGCGGTGTGGTGGTGGCCACCGTCAACAAAAAGCCCTTTACGTTCATTCTGG
AAACAGAACGTGGTCTGAATCTTTCCATTCAGGCCGTTCCCCGTGAAGGCGCGGGGCGTACCATTCAGCT
GGTCAGTGACCTGCGCGGAACCGGAGAAGAAGCCGGTGCGTGGGAAACGTCCACGCCTTACGAATCCCTG
CTTGTGACCATCAGCCAGGCCGTCCGTGGCGGAAAATTACCCGCAGGCTGGTATCAGGTCCCAGTGACAA
AGGAAACCCTGCAGGCCCCGGCGGGGCTGTCTTCAGTGGCAGATGCCGTATGGACGGGGAATCACCTGAA
GATGGTCCGCTTTGCCGTGGAAAATAAAACGCTGTCTGCCCTGAATATCCGGGAAAGTGACTTCTGGCAG
CCGGGAACCCGTGCCGTGATGTTCAGCCAGCCTGCCAGCCAGTTACTGGCAGGTGCGCGCATGGATGTGT
ATGTCATCCGTGACGGGGAGGGCAACTGA
 Primer design