SecReT4
Protein ID: 260751888
T4SS name [ID]Tra_F [533]
Gene symbol-
Locus tagECO111_p3-65
StrainEscherichia coli O111:H- str. 11128
Repliconplasmid pO111_3 [GenBank: NC_013366] [Browse all T4SS(s) in this replicon]
Location [Strand]47529..48956 [+]
Productconjugal transfer pilus assembly protein TraB
Component typeTraB_F
UniProt IDC8URH0
KEGG IDeoi:ECO111_p3-65
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.3e-40, Aligned region: 213..409
CALCOCO1 [PF07888], Evalue: 4.7e-05, Aligned region: 68..121
Protein Sequence: 475 a.a.     [Download]
>gi|260751888|ref|YP_003237802.1| pilus assembly protein TraB [Escherichia coli O111:H- str. 11128]
MASINTIVKRKQYLWLGIVVVGTASAIGGALYLSDVDMSGNGESVAEQEPVPDMTGVVDTTFDDKVRQHA
TTEMQVTAAQMQKQYEEIRRELDVLNKQRGDDQRRIEKLGQDNAALAEQVKALGANPVTATGEPVPQTPA
SPPGPEGEPQPGNTPVSFPPQGSVAVPPPTAFYPGNGVTPPPQVTYQSVPVPNRIQRKVFTRNEGKQGPS
LPYIPSGSFAKAMLIEGADANASVTGNESTVPMQLRITGLVEMPNSKTYDATGCFVGLEAWGDVSSERAI
VRTRNISCLKDGKTIDMPIKGHVSFRGKNGIKGEVVMRNGKILGWAWGAGFVDGIGQGMERASQPAVGLG
ATAAYGAGDVLKMGIGGGASKAAQTLSDYYIKRAEQYHPVIPIGAGNEVTVVFQDGFQLKTVEEMALERT
QNRAEEDNPESPVPVPPSAESHLNGFNTDQMLKQLGNLNPQQFMSGSQGGGNDGK
 
Nucleotide Sequence: 1428 bp     [Download]
>gi|260751835|ref|NC_013366.1|:47529-48956 Escherichia coli O111:H- str. 11128 plasmid pO111_3, complete sequence
ATGGCCAGTATCAATACCATTGTGAAACGCAAGCAGTACCTGTGGCTGGGGATTGTGGTTGTCGGTACAG
CCTCCGCGATTGGTGGGGCACTGTATCTGTCTGATGTGGACATGTCCGGTAACGGTGAAAGCGTGGCTGA
ACAGGAGCCTGTGCCGGATATGACCGGTGTGGTGGATACGACCTTTGATGACAAGGTGCGTCAGCATGCC
ACCACCGAGATGCAGGTGACGGCAGCGCAGATGCAGAAGCAGTATGAGGAAATCCGTCGTGAGCTGGATG
TTCTGAACAAACAGCGCGGTGATGACCAGCGTCGTATTGAAAAGTTGGGACAGGACAATGCCGCCCTGGC
AGAGCAGGTAAAAGCCCTGGGTGCTAATCCCGTCACCGCGACCGGTGAGCCAGTACCGCAGACGCCAGCC
TCACCGCCCGGCCCGGAAGGCGAACCACAGCCAGGAAACACACCCGTATCTTTCCCGCCGCAGGGCAGCG
TTGCTGTTCCACCGCCGACGGCGTTTTATCCCGGGAATGGTGTCACGCCACCACCGCAGGTGACGTACCA
GTCTGTACCGGTGCCTAACCGGATACAGCGTAAGGTGTTCACCCGTAATGAGGGAAAACAGGGACCATCA
CTGCCGTACATTCCGTCAGGAAGTTTTGCGAAAGCCATGCTGATTGAAGGAGCGGATGCCAATGCCTCAG
TCACCGGTAATGAATCCACGGTGCCGATGCAGCTGCGTATCACCGGTCTGGTGGAAATGCCGAACAGCAA
AACGTATGACGCAACGGGATGTTTTGTGGGTCTGGAAGCCTGGGGGGATGTGTCCAGTGAACGTGCCATT
GTACGCACCCGCAATATCAGCTGCCTGAAGGACGGCAAAACTATTGATATGCCGATTAAGGGGCATGTCA
GCTTCCGGGGTAAAAACGGTATCAAGGGCGAAGTGGTGATGCGTAACGGCAAAATCCTCGGCTGGGCATG
GGGCGCGGGATTTGTTGACGGTATCGGTCAGGGAATGGAGCGCGCCTCCCAGCCGGCTGTCGGGCTGGGT
GCCACTGCTGCTTACGGGGCCGGCGATGTCCTGAAAATGGGTATCGGTGGCGGCGCATCGAAAGCCGCAC
AGACGCTCAGTGACTACTACATCAAACGTGCCGAACAGTATCACCCGGTGATACCGATTGGTGCGGGCAA
CGAAGTGACCGTGGTGTTCCAGGACGGCTTCCAGCTGAAAACCGTGGAAGAGATGGCGCTGGAGCGCACG
CAGAACAGAGCGGAAGAAGATAATCCGGAAAGTCCGGTTCCTGTTCCGCCATCAGCTGAAAGTCATCTTA
ACGGCTTTAATACTGACCAGATGCTGAAGCAGCTGGGCAACCTGAATCCGCAGCAGTTTATGTCCGGCAG
CCAGGGAGGAGGCAACGATGGCAAATAA
 Primer design