SecReT4
Protein ID: 260751890
T4SS name [ID]Tra_F [533]
Gene symbol-
Locus tagECO111_p3-68
StrainEscherichia coli O111:H- str. 11128
Repliconplasmid pO111_3 [GenBank: NC_013366] [Browse all T4SS(s) in this replicon]
Location [Strand]50222..51424 [+]
Productpilus assembly protein
Component typeTraG_F
UniProt IDC8URH2
KEGG IDeoi:ECO111_p3-68
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.1e-114, Aligned region: 3..387
Protein Sequence: 400 a.a.     [Download]
>gi|260751890|ref|YP_003237804.1| pilus assembly protein [Escherichia coli O111:H- str. 11128]
MNEVYVIAGGEWLRNNLNAIAAFMGTRTWDSIEKIALTLSVLAVAVMWVQRHNVMDLLGWVAVFVLISLL
VNVRTSVQIIDNSDLVKVHRVDNVPVGLAMPLSLTTRIGHAMVASYEMIFTQPDSVTYSKTGMLFGAELV
SKSTDFLSRNPEIANLFQDYVQNCVMGDIYLNHKYTLEELMASADPYTLIFSRPSPLRGVYDSNNNFVTC
KDASVSLKDKLNLDTQSGGKTWHYYAQQLFGGRPDPNLLFSTLIGDSYSYFYGSSKSASQIIRQNVTINA
LKEGITSYAARNGDSASLVNLATTSSMEKQRLAHVSIGHVAMRTLPMTQTILTGIAIGIFPLLVLAAVFN
KLTLSVLKGYVFALMWLQSWPMLYAILNSAMTFYAKQNEPPRVSWRVFYL
 
Nucleotide Sequence: 1203 bp     [Download]
>gi|260751835|ref|NC_013366.1|:50222-51424 Escherichia coli O111:H- str. 11128 plasmid pO111_3, complete sequence
GTGAATGAAGTTTATGTGATTGCCGGTGGTGAGTGGTTGCGGAATAACCTGAACGCCATTGCCGCCTTTA
TGGGAACCAGGACGTGGGATTCCATTGAAAAAATTGCGCTCACATTGTCTGTTCTCGCGGTGGCCGTGAT
GTGGGTACAGCGGCACAACGTGATGGATTTGCTGGGCTGGGTGGCCGTGTTTGTGCTTATCAGCCTGCTG
GTTAATGTCCGCACATCGGTGCAGATTATTGATAACAGTGACCTGGTCAAAGTTCACCGGGTGGATAATG
TACCGGTCGGACTGGCGATGCCACTTTCACTGACGACCCGTATCGGGCATGCAATGGTGGCCAGTTACGA
GATGATCTTCACGCAACCGGACAGTGTCACCTATAGCAAAACGGGGATGCTGTTTGGCGCAGAACTGGTA
TCAAAAAGCACCGACTTTTTGTCCCGCAATCCGGAAATCGCCAATCTTTTCCAGGATTATGTGCAGAACT
GCGTGATGGGGGATATTTACCTGAACCACAAATACACGCTGGAGGAGCTTATGGCCTCCGCTGATCCCTA
CACGCTGATTTTTTCCCGCCCCAGTCCGCTACGGGGCGTTTATGACAGCAATAATAATTTCGTGACCTGT
AAGGACGCGTCGGTTTCGCTGAAAGACAAGCTGAATCTGGACACACAGAGTGGCGGAAAAACCTGGCATT
ATTATGCCCAGCAGTTATTTGGTGGTCGCCCTGATCCGAACCTGTTATTCAGTACCCTGATTGGCGACAG
TTACAGTTACTTCTATGGCTCAAGTAAATCAGCCAGCCAGATCATCCGCCAGAATGTCACCATTAATGCG
CTGAAGGAGGGGATCACCAGTTATGCAGCACGTAATGGTGACTCAGCCAGCCTGGTGAATCTGGCCACCA
CGTCATCGATGGAGAAGCAACGTCTGGCACATGTCTCCATCGGTCATGTGGCGATGCGGACACTGCCCAT
GACGCAGACCATCCTGACGGGGATCGCCATCGGTATTTTCCCGCTCCTGGTACTGGCGGCTGTCTTCAAC
AAACTGACGCTGTCTGTCCTGAAAGGCTATGTGTTTGCCCTGATGTGGCTGCAGTCATGGCCAATGTTGT
ACGCCATTCTGAACAGCGCCATGACATTTTATGCGAAGCAGAATGAACCGCCCCGGGTTTCCTGGAGAGT
GTTTTATCTGTGA
 Primer design