SecReT4
Protein ID: 260751895
T4SS name [ID]Tra_F [533]
Gene symbol-
Locus tagECO111_p3-74
StrainEscherichia coli O111:H- str. 11128
Repliconplasmid pO111_3 [GenBank: NC_013366] [Browse all T4SS(s) in this replicon]
Location [Strand]55864..58017 [+]
Productconjugal transfer protein TraD
Component typeTraD_F
UniProt IDC8URH7
KEGG IDeoi:ECO111_p3-74
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 3.3e-148, Aligned region: 172..561
TraD_N [PF12615], Evalue: 1.5e-33, Aligned region: 31..129
TraG-D_C [PF12696], Evalue: 1e-18, Aligned region: 419..541
AAA_10 [PF12846], Evalue: 2.1e-10, Aligned region: 399..491
T4SS-DNA_transf [PF02534], Evalue: 5.9e-08, Aligned region: 362..477
Protein Sequence: 717 a.a.     [Download]
>gi|260751895|ref|YP_003237809.1| coupling protein TraD [Escherichia coli O111:H- str. 11128]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTENPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGESFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQARPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAEQPQQPVSPAI
NDKKSDSGVNVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYEAWQQENHPDIQQQMQRREEVN
INVHRERGEDVEPGDDF
 
Nucleotide Sequence: 2154 bp     [Download]
>gi|260751835|ref|NC_013366.1|:55864-58017 Escherichia coli O111:H- str. 11128 plasmid pO111_3, complete sequence
ATGAGTTTTAACGCAAAGGATATGACCCAGGGCGGTCAGATTGCGTCCATGCGTATCCGCATGTTCAGCC
AGATCGCCAATATCATGCTTTACTGCCTGTTTATTTTTTTCTGGATACTCGTTGGTCTGGTTTTATGGGT
AAAAATAAGCTGGCAGACGTTTGTGAACGGCTGTATTTACTGGTGGTGTACCACGCTGGAAGGCATGCGG
GATTTAATCAAGTCCCAGCCGGTATATGAGATCCAGTATTACGGCAAAACCTTCCGGATGAACGCTGCTC
AGGTACTGCATGATAAATATATGATCTGGTGCGGAGAGCAGCTATGGTCCGCATTCGTTCTGGCTACAGT
TGTGGCACTGGTTATTTGCCTGATTACCTTCTTTGTTGTCTCCTGGATTCTGGGGCGTCAGGGTAAACAA
CAGAGCGAAAATGAAGTCACAGGTGGTCGTCAGCTGACGGAGAACCCGAAAGACGTTGCCCGGATGCTGA
AAAAAGACGGCAAGGACTCCGATATACGGATTGGCGACCTGCCGATTATCCGGGATTCCGAAATCCAGAA
CTTCTGTCTGCACGGCACGGTCGGGGCCGGTAAGTCGGAAGTTATCCGTCGTCTGGCCAACTACGCCCGT
CAGCGTGGAGATATGGTGGTGATTTATGACCGTTCAGGGGAATTTGTTAAAAGTTACTATGATCCCTCCA
TCGATAAGATACTGAATCCGCTGGATGCCCGCTGTGCCGCCTGGGATTTGTGGAAGGAGTGCCTGACACA
GCCGGATTTTGATAATACCGCGAACACGCTGATCCCGATGGGCACAAAAGAGGACCCGTTCTGGCAGGGT
TCAGGACGTACCATTTTTGCGGAAGCGGCGTACCTGATGCGTAATGACCCCAACCGCAGCTACAGCAAAC
TGGTGGACACACTGCTTTCCATCAAAATCGAAAAACTGCGAACCTTCCTGCGTAATTCACCGGCGGCCAA
CCTGGTGGAAGAGAAAATTGAGAAAACGGCTATTTCCATCCGTGCTGTGCTGACCAACTATGTGAAAGCC
ATCCGTTACCTGCAGGGGATTGAGCATAACGGTGAGTCTTTTACCATCCGTGACTGGATGCGGGGTGTCC
GGGAAGATCAGAAAAACGGCTGGCTGTTTATCTCGTCGAATGCCGACACCCATGCCTCCCTGAAGCCGGT
GATCTCCATGTGGCTGTCCATTGCCATTCGTGGTCTGCTGGCAATGGGAGAAAACCGTAACCGTCGTGTG
TGGTTTTTCTGTGATGAGCTACCCACGTTACACAAACTGCCGGACCTGGTGGAGATCCTGCCGGAAGCCC
GTAAGTTCGGTGGCTGTTATGTGTTTGGTATCCAGTCCTATGCCCAGCTGGAAGATATCTACGGTGAGAA
AGCGGCTGCCACGCTGTTTGACGTCATGAACACCCGTGCCTTTTTCCGTTCTCCCAGCCATAAGATTGCA
GAGTTCGCTGCCGGTGAGATTGGTGAGAAAGAGCACCTGAAAGCCAGCGAGCAGTATTCCTACGGTGCTG
ATCCGGTACGTGACGGGGTATCGACCGGTAAGGATATGGAGCGCCAGACGCTGGTCAGTTATTCCGACAT
TCAGTCTCTGCCGGATCTGACCTGTTATGTCACCTTGCCCGGACCGTATCCGGCAGTAAAACTCTCACTG
AAATATCAGGCACGTCCGAAGGTTGCCCCTGAGTTTATTCCGCGTGACATCAACCCGGAAATGGAGAACC
GTCTGAGTGCCGTACTTGCCGCAAGGGAAGCAGAAGGTCGTCAGATGGCCAGCCTCTTCGAACCGGATGT
GCCGGAAGTTGTTTCCGGAGAAGACGTGACTCAGGCTGAACAGCCGCAACAGCCGGTGTCTCCTGCCATC
AACGATAAGAAGTCAGATTCAGGTGTGAATGTTCCGGCAGGGGGGATCGAGCAGGAGCTGAAAATGAAAC
CGGAAGAAGAGATGGAACAGCAACTGCCACCCGGGATCAGTGAATCCGGTGAAGTGGTGGATATGGCCGC
TTATGAGGCATGGCAACAGGAAAATCATCCGGACATCCAGCAGCAGATGCAGCGTCGTGAAGAGGTGAAC
ATTAATGTGCACCGGGAGCGTGGGGAGGATGTTGAGCCGGGAGATGATTTCTGA
 Primer design