SecReT4
Protein ID: 260751896
T4SS name [ID]Tra_F [533]
Gene symbol-
Locus tagECO111_p3-75
StrainEscherichia coli O111:H- str. 11128
Repliconplasmid pO111_3 [GenBank: NC_013366] [Browse all T4SS(s) in this replicon]
Location [Strand]58017..63287 [+]
Productconjugal transfer nickase/helicase TraI
Component typeTraI_F
UniProt IDC8URH8
KEGG IDeoi:ECO111_p3-75
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 4e-87, Aligned region: 7..287
TraI [PF07057], Evalue: 1.1e-58, Aligned region: 1434..1560
AAA_30 [PF13604], Evalue: 5.4e-42, Aligned region: 968..1156
UvrD_C_2 [PF13538], Evalue: 4.8e-06, Aligned region: 1341..1444
AAA_19 [PF13245], Evalue: 1.4e-05, Aligned region: 982..1047
Protein Sequence: 1756 a.a.     [Download]
>gi|260751896|ref|YP_003237810.1| nickase [Escherichia coli O111:H- str. 11128]
MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGRGAEQLGLQGSVDKDVFTRLLEGRLPDGADLSRMQ
DGSNKHRPGYDLTFSAPKSVSMMAMLGGDKRLIEAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQEPQLHTHAVVANVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEA
LGYETEVVGKHGMWEMPGVPVEAFSGRSQTIREAVGEDASLKSRDVAALDTRKSKQHVDPEVRMAEWMQT
LKETGFDIRAYRDAADQRAETRTQAPGAVSQEGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
NGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELVMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGR
RQLLEGMAFTPGSTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRW
QGGEQRPATIISEPDRNVRYARLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVLGHQEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLTLRDAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPATLPVADSTFTALKL
ENGWVETPGHSVSDSAKVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KARAGETSLETAISHQKSALHTPAQQAIHLALPVVESKNLAFSHVDLLTEAKSFAAEGTSFTELGREIDA
QIKRGDLLHVDVAKGYGTDLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMETLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLSASERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVAIMKEIVRQTPELREAVYSLINRDVERALSGLESVKPSQVPRLEGAWAPEHSVTEFSHSQEAKLAEA
QQKAMLKGEAFPDVPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQVM
VPVLNTANIRDGELRRLSTWENNPDALALVDNVYHRIVGISKDDGLITLQDAEGNTRLISPREAVAEGVT
LYTPDTIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQEQAEQHIDLAYAI
TAHGAQGASETFAIALEGTEGNRKQMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVF
EPKPDREVMNAQRLFSTARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGRSAG
IWLNPLTTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQEGVRIARDNPDSGVVVRIAGE
GRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEIVRKMAENKPDLP
DGRTEQAVREIAGQERDRAAITEREAALPESVLRESQREREAVREVARENLLQERLQQMERDMVRDLQKE
KTLGGD
 
Nucleotide Sequence: 5271 bp     [Download]
>gi|260751835|ref|NC_013366.1|:58017-63287 Escherichia coli O111:H- str. 11128 plasmid pO111_3, complete sequence
ATGATGAGTATCGCGCAGGTCAGATCGGCCGGAAGTGCCGGTAACTATTATACCGACAAGGATAATTACT
ATGTACTGGGCAGCATGGGAGAACGCTGGGCCGGCAGGGGGGCTGAACAGCTGGGACTGCAGGGCAGTGT
CGATAAGGATGTTTTTACCCGTCTTCTGGAGGGAAGGCTGCCGGACGGAGCGGATCTAAGCCGCATGCAG
GATGGCAGTAATAAGCATCGTCCCGGCTACGACCTGACCTTCTCCGCCCCCAAAAGTGTCTCCATGATGG
CCATGCTCGGGGGGGACAAACGTCTTATTGAAGCACATAACCAGGCCGTGGACTTTGCTGTTCGTCAGGT
GGAGGCGCTGGCCTCCACACGGGTGATGACGGACGGACAGTCAGAAACGGTACTGACCGGTAATCTGGTG
ATGGCACTGTTTAACCACGACACCAGTCGCGATCAGGAACCACAGTTACACACGCATGCGGTGGTGGCTA
ATGTCACGCAGCATAACGGTGAGTGGAAGACACTGAGCAGTGACAAAGTGGGGAAAACGGGGTTCATTGA
GAATGTGTACGCTAATCAGATTGCCTTTGGCAGGCTCTACCGGGAAAAACTGAAAGAGCAGGTTGAGGCG
CTGGGCTATGAAACCGAAGTGGTGGGTAAGCACGGTATGTGGGAGATGCCGGGCGTACCGGTGGAGGCCT
TTTCCGGACGCTCACAGACTATCCGGGAGGCCGTCGGGGAAGATGCCTCGCTGAAATCCCGGGATGTGGC
GGCACTGGATACGCGAAAATCCAAACAGCACGTCGATCCTGAAGTCAGAATGGCTGAATGGATGCAGACG
CTGAAGGAAACCGGGTTCGACATCCGGGCATATCGTGACGCGGCGGATCAGCGTGCGGAGACCCGCACGC
AGGCGCCCGGGGCTGTTTCACAGGAGGGGCCGGATGTGCAGCAGGCGGTGACACAGGCGATTGCCGGATT
AAGTGAACGAAAAGTGCAGTTTACGTACACGGACGTGCTGGCCAGAACGGTCGGTATACTGCCGCCGGAA
AATGGTGTGATTGAACGGGCACGCGCCGGTATCGATGAGGCCATCAGTCGTGAGCAGCTTATCCCCCTCG
ACCGTGAGAAGGGGCTGTTCACATCAGGAATTCATGTGCTCGATGAGCTGTCCGTCCGGGCACTCAGTCG
TGACATCATGAAACAGAACCGGGTGACCGTACATCCGGAGAAAAGTGTCCCCCGGACGGCTGGTTACAGC
GATGCGGTCAGTGTTCTGGCACAGGACCGTCCGTCGCTGGCCATTGTGTCCGGGCAGGGCGGTGCAGCCG
GGCAGCGTGAGCGGGTGGCTGAACTGGTCATGATGGCCCGGGAGCAGGGGCGGGAGGTGCAGATTATCGC
TGCTGACCGTCGCTCGCAGATGAACCTGAAGCAGGATGAACGGTTGTCCGGTGAGCTGATAACCGGACGT
CGTCAGCTGCTGGAAGGCATGGCCTTCACGCCGGGCAGTACTGTTATCGTTGACCAGGGCGAAAAACTCT
CCCTGAAAGAGACGTTAACCCTGCTGGACGGTGCCGCACGTCATAACGTACAGGTCCTGATAACCGACAG
CGGGCAGCGAACCGGTACAGGCAGTGCACTGATGGCCATGAAGGATGCCGGGGTGAACACATATCGCTGG
CAGGGGGGAGAACAGCGACCGGCCACCATCATCAGTGAACCAGACCGTAATGTCCGCTATGCCCGGCTGG
CCGGAGATTTTGCGGCCAGCGTGAAAGCCGGAGAAGAGAGCGTGGCACAGGTCAGTGGGGTACGGGAACA
GGCCATACTGACACAGGCCATTCGCAGTGAGCTGAAAACACAGGGCGTGCTCGGACATCAGGAGGTGACC
ATGACGGCACTGTCACCGGTCTGGCTGGATAGCCGGAGCCGTTATCTGCGGGATATGTACCGCCCGGGAA
TGGTGATGGAGCAGTGGAATCCGGAGACACGCAGTCATGACCGCTATGTGATAGACCGGGTGACGGCACA
GAGTCACAGCCTGACCCTGCGGGATGCGCAGGGGGAAACGCAGGTGGTGCGTATTTCCTCCCTGGACAGC
AGCTGGTCGCTGTTCCGGCCGGAAAAAATGCCGGTGGCAGACGGCGAGCGACTGAGGGTGACAGGGAAAA
TTCCCGGACTCCGCGTCTCCGGCGGTGACCGCCTGCAGGTGGCATCCGTCAGTGAAGATGCGATGACGGT
TGTTGTGCCGGGGCGGGCTGAACCGGCCACCCTGCCTGTGGCTGATTCAACGTTCACGGCACTGAAGCTG
GAGAACGGCTGGGTGGAAACGCCCGGGCATTCCGTCAGTGACAGTGCGAAGGTTTTTGCCTCCGTCACAC
AGATGGCAATGGACAACGCCACCCTGAACGGTCTGGCCCGCAGCGGTCGTGATGTCCGGCTGTATTCCTC
ACTGGATGAAACCCGTACTGCGGAAAAACTTGCCCGCCATCCCTCCTTTACGGTGGTTTCTGAGCAGATA
AAGGCGCGTGCCGGTGAGACATCGCTGGAAACGGCTATCAGTCATCAGAAGTCCGCACTTCACACGCCGG
CACAGCAGGCCATTCATCTGGCCCTTCCGGTGGTGGAAAGTAAAAACCTGGCCTTCAGCCATGTGGACCT
GCTGACAGAGGCAAAGTCGTTTGCTGCAGAAGGAACCAGTTTTACTGAACTGGGGCGGGAAATCGATGCG
CAGATAAAACGGGGTGATTTACTGCATGTGGATGTGGCTAAAGGCTATGGCACAGACCTGCTGGTTTCCC
GTGCGTCGTATGAGGCAGAAAAGAGCATTCTTCGCCATATTCTCGAGGGTAAGGAGGCGGTCACGCCGCT
GATGGAGAGAGTACCCGGCGAACTCATGGAGACGTTAACGTCGGGACAGCGTGCCGCCACCCGTATGATA
CTGGAAACGTCCGACCGTTTCACGGTGGTACAGGGTTATGCCGGTGTGGGTAAGACCACACAGTTCCGGG
CGGTGATGTCAGCCGTGAACATGCTGTCGGCGAGTGAGCGTCCCCGAGTTGTGGGGCTGGGGCCCACGCA
CCGTGCGGTCGGTGAGATGCGCAGCGCCGGCGTGGATGCACAGACGCTGGCGTCCTTTCTGCATGACACG
CAGCTGCAGCAGCGCAGCGGAGAAACGCCGGATTTCAGCAACACGCTGTTTCTGCTCGATGAGAGCTCAA
TGGTGGGCAATACCGACATGGCACGGGCATACGCCCTGATTGCGGCCGGTGGCGGTCGTGCTGTGGCCAG
CGGTGACACGGACCAGCTGCAGGCCATCGCGCCCGGTCAGCCTTTCCGTCTCCAGCAGACGCGCAGTGCT
GCCGATGTGGCCATCATGAAAGAGATTGTGCGTCAGACGCCGGAACTGCGGGAGGCGGTATACAGCCTGA
TTAACCGGGATGTGGAAAGGGCACTGTCCGGGCTTGAGAGTGTGAAACCGTCTCAGGTGCCACGTCTGGA
GGGCGCATGGGCACCGGAGCACTCCGTGACGGAGTTCAGTCACAGCCAGGAAGCGAAACTGGCAGAAGCG
CAGCAGAAGGCGATGCTGAAAGGCGAGGCTTTCCCGGATGTCCCCATGACACTGTATGAAGCCATTGTCC
GCGACTATACCGGCAGAACACCGGAAGCACGGGAGCAGACGCTGATTGTCACGCACCTGAATGAGGACCG
GCGCGTGCTGAACAGCATGATTCATGATGCACGGGAAAAGGCCGGTGAGCTGGGAAAAGAGCAGGTCATG
GTGCCTGTCCTGAACACAGCGAATATACGCGACGGGGAGCTGCGTCGTCTCTCCACCTGGGAGAATAACC
CGGATGCACTTGCCCTGGTGGATAATGTGTATCACCGGATTGTCGGTATCAGCAAGGATGACGGGCTGAT
AACCCTGCAGGATGCGGAAGGTAACACGCGGCTGATTTCGCCCCGGGAGGCGGTGGCTGAAGGCGTCACA
CTGTACACCCCGGACACCATCCGGGTGGGGACCGGTGACCGGATGCGCTTCACGAAGAGTGACCGGGAGC
GCGGTTATGTGGCCAACAGCGTCTGGACGGTGACAGCAGTTTCCGGTGACAGTGTCACGCTGTCGGACGG
ACAGCAGACCCGGGTGATTCGCCCCGGCCAGGAGCAGGCAGAGCAACATATTGACCTGGCCTATGCCATC
ACCGCTCACGGTGCGCAGGGGGCGAGTGAAACCTTTGCCATCGCGCTTGAAGGCACGGAAGGTAACCGGA
AACAGATGGCCGGCTTTGAGTCAGCCTACGTGGCCCTGTCGCGTATGAAGCAGCATGTGCAGGTGTACAC
CGATAACCGTCAGGGCTGGACGGATGCCATTAACAATGCCGTACAGAAAGGAACTGCCCACGATGTGTTT
GAGCCGAAACCGGACCGGGAGGTCATGAATGCGCAGCGGCTGTTCAGTACGGCACGGGAACTGCGGGACG
TGGCGGCAGGCCGTGCCGTTCTCCGTCAGGCGGGGCTGGCCGGGGGAGACAGTCCTGCACGGTTTATTGC
TCCGGGACGTAAATATCCGCAACCGTATGTGGCACTGCCGGCTTTTGACCGTAACGGCAGGTCCGCCGGT
ATCTGGCTGAACCCGCTGACCACGGATGACGGAAACGGGCTGCGGGGATTCAGCGGTGAAGGTCGGGTAA
AAGGCAGCGGGGATGCGCAGTTCGTGGCCCTGCAGGGCAGCCGTAACGGAGAAAGCCTGCTGGCTGATAA
TATGCAGGAGGGTGTCCGGATTGCCCGTGATAATCCTGACAGCGGTGTGGTGGTGAGAATCGCCGGTGAA
GGCCGTCCGTGGAATCCCGGTGCCATCACCGGTGGTCGCGTGTGGGGGGATATCCCGGACAACAGCGTCC
AGCCGGGGGCCGGAAATGGTGAACCGGTTACAGCTGAAGTGCTGGCACAGCGGCAGGCTGAAGAGGCCAT
CCGCCGTGAAACGGAACGTCGCGCAGATGAAATTGTCCGTAAAATGGCAGAGAACAAACCTGACCTGCCG
GATGGCAGAACAGAGCAGGCTGTCAGGGAGATTGCCGGGCAGGAGCGTGACCGGGCTGCCATAACTGAAC
GGGAAGCCGCGCTGCCGGAGAGTGTGCTGCGTGAATCACAACGGGAGCGGGAAGCGGTCCGGGAGGTTGC
CCGGGAAAATCTGCTGCAGGAGCGTCTGCAGCAGATGGAGCGGGATATGGTCCGTGACCTGCAGAAAGAG
AAAACCCTGGGCGGAGACTGA
 Primer design