SecReT4
Protein ID: 260751897
T4SS name [ID]Tra_F [533]
Gene symbol-
Locus tagECO111_p3-76
StrainEscherichia coli O111:H- str. 11128
Repliconplasmid pO111_3 [GenBank: NC_013366] [Browse all T4SS(s) in this replicon]
Location [Strand]63307..64053 [+]
Productconjugal transfer pilus acetylation protein TraX
Component typeTraX_F
UniProt IDC8URH9
KEGG IDeoi:ECO111_p3-76
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 2.1e-52, Aligned region: 32..247
Protein Sequence: 248 a.a.     [Download]
>gi|260751897|ref|YP_003237811.1| putative F pilin acetylation protein TraX [Escherichia coli O111:H- str. 11128]
MTTDNTNTTRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLMVLDHINLIFQLKQEWMFLAGRGAFPL
FALVWGLNLSRHAHIRQPAINRLWGWGIIAQFAYYLAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAA
AILLMALWGPLSGSSYGIAGLLMLAVSHRLYRAEDRAERLALVACLLAVIPALNLATSDAAAVAGLVMTV
LTVGLVSCAGKSLPRFWPGDFFPVFYACHLAVLGVLAL
 
Nucleotide Sequence: 747 bp     [Download]
>gi|260751835|ref|NC_013366.1|:63307-64053 Escherichia coli O111:H- str. 11128 plasmid pO111_3, complete sequence
ATGACAACGGATAACACGAATACGACACGTAACGATTCACTGGCTGCACGGACCGATACCTGGTTGCAGT
CGTTTCTGGTCTGGTCACCCGGACAGCGGGATATCATCAAAACGGTGGCACTGGTGCTGATGGTACTGGA
CCACATCAATCTGATATTCCAGCTGAAGCAGGAATGGATGTTTCTGGCCGGGCGAGGAGCCTTTCCGCTG
TTTGCCCTGGTGTGGGGGCTGAATCTGTCCCGTCATGCGCATATCCGGCAACCGGCCATTAACCGGCTGT
GGGGATGGGGAATTATTGCCCAGTTCGCATATTATCTGGCCGGCTTTCCCTGGTATGAGGGGAATATCCT
GTTTGCCTTTGCAGTGGCGGCACAGGTGCTGACGTGGTGTGAAACGCGCAGTGGGTGGCGTACAGCAGCG
GCCATTCTTCTGATGGCCCTGTGGGGGCCTTTGTCCGGCTCCAGTTACGGCATTGCCGGGCTGCTGATGC
TGGCAGTCAGTCACCGGCTGTACCGGGCGGAAGACAGAGCGGAACGTCTGGCGCTGGTCGCCTGCCTGCT
GGCTGTTATTCCAGCGCTTAACCTTGCCACCAGTGATGCAGCGGCGGTGGCCGGTCTTGTGATGACGGTG
CTGACCGTTGGTCTGGTGTCGTGTGCAGGAAAATCATTACCCCGTTTCTGGCCCGGGGATTTTTTCCCGG
TATTCTACGCCTGTCATCTGGCTGTGCTGGGCGTTCTGGCGTTGTGA
 Primer design