SecReT4
Protein ID: 260751970
T4SS name [ID]Tra_F [87]
Gene symbol-
Locus tagECO26_p2-42
StrainEscherichia coli O26:H11 str. 11368
Repliconplasmid pO26_2 [GenBank: NC_013362] [Browse all T4SS(s) in this replicon]
Location [Strand]26563..26874 [+]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDC8TWD1
KEGG IDeoj:ECO26_p2-42
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 4.3e-37, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|260751970|ref|YP_003232508.1| conjugal transfer protein TraL [Escherichia coli O26:H11 str. 11368]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGITTSKYLFGIGAAVLVYFGIKKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|260751930|ref|NC_013362.1|:26563-26874 Escherichia coli O26:H11 str. 11368 plasmid pO26_2, complete sequence
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTATTGGCTGGGGTATCACAACATCGAAATA
TCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design