SecReT4
Protein ID: 260751991
T4SS name [ID]Tra_F [87]
Gene symbol-
Locus tagECO26_p2-63
StrainEscherichia coli O26:H11 str. 11368
Repliconplasmid pO26_2 [GenBank: NC_013362] [Browse all T4SS(s) in this replicon]
Location [Strand]41068..41826 [+]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDC8TWF2
KEGG IDeoj:ECO26_p2-63
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 6.3e-79, Aligned region: 28..242
Protein Sequence: 252 a.a.     [Download]
>gi|260751991|ref|YP_003232529.1| conjugal transfer protein TraF [Escherichia coli O26:H11 str. 11368]
MKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQKLAALQTATKRA
LYEAILYPGVDNFVKYFRLQNYWTQQAGLFTMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAADQAQQRQ
AIAKLAEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVKY
FPAMMLVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 759 bp     [Download]
>gi|260751930|ref|NC_013362.1|:41068-41826 Escherichia coli O26:H11 str. 11368 plasmid pO26_2, complete sequence
ATGAAAGGAATGAAGATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTATTTTTCCGGCGTCAG
GAAAAGATGCAGGCTGGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAAAGAAAATAAACCAGTACC
TGCAGCCCCCCGTCAGGAGCCGGACATTATGCAGAAACTGGCCGCACTGCAGACGGCAACAAAGCGGGCG
CTGTACGAAGCCATTCTGTATCCCGGCGTGGATAATTTTGTGAAATATTTCCGGCTGCAGAATTACTGGA
CTCAGCAGGCCGGGCTTTTCACCATGAGCGCCAAAAAAGCCATGCTGGCGCATCCCGAACTGGACTATAA
CCTGCAGTACAGCCATTACAACGGCACGGTCCGGAACCAGCTGGCGGCAGACCAGGCGCAGCAGCGACAG
GCCATTGCGAAACTGGCTGAACACTACGGCATCATGTTCTTTTACCGGGGGCAGGACCCCATCGACGGGC
AGCTGGCGCAGGTCATTAATGGCTTCAGGGATACCTATGGTCTGAGTGTTATTCCCGTTTCCGTGGATGG
TGTGATTAATCCGCTGTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAGCGCCTCGGCGTGAAATAT
TTCCCGGCCATGATGCTGGTTGACCCGAAACAGGGCAGTGTTCGTCCGTTATCATACGGTTTTATTTCGC
AGGACGACCTGGCAAAACAGTTCCTGAACGTTTCTGAAGATTTTAAACCGAACTTCTGA
 Primer design