SecReT4
Protein ID: 260751992
T4SS name [ID]Tra_F [87]
Gene symbol-
Locus tagECO26_p2-64
StrainEscherichia coli O26:H11 str. 11368
Repliconplasmid pO26_2 [GenBank: NC_013362] [Browse all T4SS(s) in this replicon]
Location [Strand]41942..42223 [+]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDC8TWF3
KEGG IDeoj:ECO26_p2-64
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 9.8e-51, Aligned region: 1..93
Protein Sequence: 93 a.a.     [Download]
>gi|260751992|ref|YP_003232530.1| putative conjugal transfer protein TraQ [Escherichia coli O26:H11 str. 11368]
MHKYKFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSREE
REALEARQQAMMAEQQEGGHVSH
 
Nucleotide Sequence: 282 bp     [Download]
>gi|260751930|ref|NC_013362.1|:41942-42223 Escherichia coli O26:H11 str. 11368 plasmid pO26_2, complete sequence
GTGCATAAATATAAATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGTGTCT
GGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGTTGATTGC
GGCCATCCTTGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCCCGTGTCAGCCGGGAAGAG
CGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGCAGAGCAGCAGGAGGGCGGACATGTCTCTCACT
AA
 Primer design