SecReT4
Protein ID: 260752004
T4SS name [ID]Tra_F [87]
Gene symbol-
Locus tagECO26_p2-77
StrainEscherichia coli O26:H11 str. 11368
Repliconplasmid pO26_2 [GenBank: NC_013362] [Browse all T4SS(s) in this replicon]
Location [Strand]57919..58665 [+]
Productconjugal transfer pilus acetylation protein TraX
Component typeTraX_F
UniProt IDC8TWG5
KEGG IDeoj:ECO26_p2-77
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 6.8e-52, Aligned region: 32..247
Protein Sequence: 248 a.a.     [Download]
>gi|260752004|ref|YP_003232542.1| conjugal transfer protein TraX [Escherichia coli O26:H11 str. 11368]
MTTDNTNTTRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLMVLDHINLIFQLKQEWMFLAGRGAFPL
FALVWGLNLSRHAHIRQVAINRLWGWGVIAQFAYYLAGFPWYEGNILFAFAVVAQVLMWSETRTWWRSAG
CMLLLAVWLPLSGTSYGIAGLLMLAVSHRLYQAEDRMERLALVACLLAVIPALNLATSNAAAVAGLVMTV
LTVGLVSCAGKSLPRFWPGDFFPVFYACHLAVLGVLAL
 
Nucleotide Sequence: 747 bp     [Download]
>gi|260751930|ref|NC_013362.1|:57919-58665 Escherichia coli O26:H11 str. 11368 plasmid pO26_2, complete sequence
ATGACAACGGATAACACGAACACGACACGTAACGATTCACTGGCTGCCCGGACCGATACCTGGTTGCAGT
CGTTTCTGGTCTGGTCACCCGGACAGCGGGATATCATCAAAACGGTGGCACTGGTGCTGATGGTACTGGA
CCACATCAATCTGATATTCCAGCTGAAGCAGGAATGGATGTTTCTGGCCGGGCGTGGAGCCTTTCCGCTG
TTTGCCCTGGTGTGGGGGCTGAATCTGTCCCGTCATGCGCATATCCGGCAGGTGGCCATTAACCGGCTGT
GGGGATGGGGAGTGATTGCCCAGTTCGCGTATTATCTGGCCGGTTTTCCCTGGTATGAAGGAAATATCCT
GTTTGCCTTTGCGGTTGTGGCACAGGTGCTGATGTGGAGTGAAACGCGCACCTGGTGGCGTTCCGCAGGG
TGCATGTTGCTGCTGGCAGTATGGCTGCCTTTGTCCGGTACCAGTTACGGCATTGCCGGGCTGCTGATGC
TGGCGGTCAGCCACCGGTTGTATCAGGCGGAAGACAGAATGGAACGTCTGGCGCTGGTTGCATGCCTGCT
GGCCGTGATTCCGGCGCTTAACCTTGCCACCAGTAATGCGGCGGCTGTAGCCGGCCTTGTGATGACAGTG
CTGACTGTTGGTCTGGTGTCGTGTGCAGGGAAATCCTTACCCCGTTTCTGGCCCGGAGATTTTTTCCCGG
TATTCTACGCCTGTCATCTGGCTGTGCTGGGCGTTCTGGCACTGTGA
 Primer design