SecReT4
Protein ID: 260752016
T4SS name [ID]Tra_F [570]
Gene symbol-
Locus tagECO111_p1-004
StrainEscherichia coli O111:H- str. 11128
Repliconplasmid pO111_1 [GenBank: NC_013365] [Browse all T4SS(s) in this replicon]
Location [Strand]2635..2952 [+]
Productputative plasmid transfer protein
Component typeTraL_F
UniProt IDC8UQC8
KEGG IDeoi:ECO111_p1-004
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.9e-08, Aligned region: 11..82
Protein Sequence: 105 a.a.     [Download]
>gi|260752016|ref|YP_003237531.1| putative plasmid transfer protein [Escherichia coli O111:H- str. 11128]
MTSQYEIPPHTYRFPYRINMPLLILFWDAKQLGITFVTIASGNIFDFFITSVVVAVVFWFAYKKAAEEGI
RGKLKHKLWWYGFFPGKSVFSSRYFTDPFIRNLYS
 
Nucleotide Sequence: 318 bp     [Download]
>gi|260752012|ref|NC_013365.1|:2635-2952 Escherichia coli O111:H- str. 11128 plasmid pO111_1, complete sequence
ATGACAAGCCAGTACGAGATACCGCCACATACATATCGCTTTCCATACAGAATAAATATGCCGTTACTAA
TTCTATTCTGGGATGCAAAGCAATTGGGTATAACATTCGTGACTATCGCGAGCGGTAATATTTTTGATTT
CTTTATAACTTCGGTAGTTGTGGCGGTGGTGTTCTGGTTTGCATATAAGAAAGCAGCAGAGGAAGGGATT
AGAGGAAAACTAAAACACAAACTGTGGTGGTACGGCTTTTTTCCTGGAAAATCGGTGTTTAGTAGTCGTT
ACTTTACCGATCCATTTATCAGAAACCTCTATTCTTGA
 Primer design