SecReT4
Protein ID: 260752162
T4SS name [ID]Tra_F [570]
Gene symbol-
Locus tagECO111_p1-159
StrainEscherichia coli O111:H- str. 11128
Repliconplasmid pO111_1 [GenBank: NC_013365] [Browse all T4SS(s) in this replicon]
Location [Strand]144454..145500 [-]
Productputative pilus assembly protein
Component typeTraF_F
UniProt IDC8UQS4
KEGG IDeoi:ECO111_p1-159
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.9e-49, Aligned region: 45..267
Thioredoxin_2 [PF13098], Evalue: 2.5e-07, Aligned region: 174..265
Protein Sequence: 348 a.a.     [Download]
>gi|260752162|ref|YP_003237677.1| putative pilus assembly protein [Escherichia coli O111:H- str. 11128]
MTRLTLIPSKMLVLLSLFITGVHANEEQALIKDTPFVSGQAFKKGFFWYDDPTRKTEEEITETKPPVASS
TQPEQEEKIELNSKWLKDNMPQLLTKAMDNPTPENLSRFYTAQRLMLDIGTRFSDKSKDYFLKNPMMSEK
RRQPVEKVALDAHRTVVEKNQQSVMKDIFTKSGLFFFFQSTCQFCHEESQILQFMENYYSVDILPVSMDG
RPLQNGLFQDFSVPNAQIIDQFKIREVPTIFLVSKDGSSAQRISEGMITAEELKNTIILAAKGMKLIDDA
SFQSTLDIKRQYTIGEDGVITVNKSEMDSDPFLLQRIMDKKLEGYDMPTADPVNYLNVGGSLGGAYAR
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|260752012|ref|NC_013365.1|:c145500-144454 Escherichia coli O111:H- str. 11128 plasmid pO111_1, complete sequence
ATGACTCGATTAACGTTAATACCTTCAAAGATGTTAGTGCTGCTGTCTTTGTTTATTACTGGGGTCCATG
CAAATGAAGAGCAGGCCCTTATCAAAGACACTCCCTTTGTATCAGGACAGGCCTTCAAGAAAGGCTTTTT
CTGGTATGACGACCCGACAAGGAAAACTGAGGAAGAAATTACAGAGACCAAGCCTCCTGTTGCATCTTCG
ACCCAGCCAGAACAAGAAGAAAAGATTGAGCTTAATTCAAAGTGGCTAAAGGACAATATGCCTCAGCTTT
TGACCAAGGCTATGGATAATCCGACCCCTGAAAATTTATCGAGATTTTATACAGCACAACGTTTAATGCT
GGATATCGGTACGCGGTTTTCGGATAAATCGAAAGATTATTTCCTTAAAAATCCAATGATGTCTGAAAAA
CGCAGGCAACCGGTTGAAAAGGTAGCGCTCGATGCACATCGTACGGTGGTCGAGAAAAATCAGCAGTCGG
TTATGAAAGATATTTTCACTAAATCCGGGCTGTTTTTCTTTTTCCAGAGTACTTGTCAGTTCTGCCACGA
AGAAAGTCAAATACTCCAGTTTATGGAGAATTACTATTCTGTCGACATTCTTCCTGTCAGCATGGACGGC
AGACCACTACAGAATGGGTTGTTCCAGGATTTCTCTGTACCTAATGCGCAGATTATTGATCAATTTAAAA
TCCGTGAAGTTCCAACTATTTTCCTTGTCTCAAAAGATGGGTCATCAGCGCAACGAATAAGCGAAGGCAT
GATCACTGCTGAGGAGCTCAAGAATACTATTATTCTGGCTGCAAAAGGCATGAAGCTGATTGATGATGCC
TCTTTCCAGTCCACTTTAGATATTAAGCGCCAATATACCATTGGCGAGGATGGCGTAATTACTGTGAATA
AATCAGAAATGGACTCTGACCCGTTCTTATTGCAACGAATAATGGATAAGAAACTGGAAGGGTACGATAT
GCCAACGGCGGACCCAGTGAACTATCTGAATGTGGGTGGAAGTTTAGGAGGTGCATATGCGCGCTGA
 Primer design