SecReT4
Protein ID: 260753588
T4SS name [ID]Trb [476]
Gene symbol-
Locus tagZa10_1357
StrainZymomonas mobilis subsp. mobilis NCIMB 11163
Repliconchromosome [GenBank: NC_013355] [Browse all T4SS(s) in this replicon]
Location [Strand]1573717..1574049 [+]
Productconjugal transfer protein Trbc
Component typeTrbC
UniProt IDC8WDW1
KEGG IDzmn:Za10_1357
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.6e-23, Aligned region: 9..100
Protein Sequence: 110 a.a.     [Download]
>gi|260753588|ref|YP_003226481.1| conjugal transfer protein Trbc [Zymomonas mobilis subsp. mobilis NCIMB 11163]
MIRTISRGCRIMATAAATVSISLMLAPAAHASGSSMPWEAPLQSILQSIEGPVAKIIAVIVIIATGLALA
FGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALI
 
Nucleotide Sequence: 333 bp     [Download]
>gi|260752245|ref|NC_013355.1|:1573717-1574049 Zymomonas mobilis subsp. mobilis NCIMB 11163 chromosome, complete genome
ATGATCCGCACGATTTCACGCGGCTGCCGCATCATGGCAACCGCCGCTGCCACTGTTTCCATCAGTCTGA
TGCTGGCGCCTGCCGCACACGCCTCCGGCTCCTCCATGCCCTGGGAGGCCCCGCTTCAGTCGATCCTCCA
GTCGATCGAGGGTCCTGTCGCCAAGATCATCGCCGTCATCGTCATCATCGCCACCGGCCTGGCGCTGGCC
TTCGGTGATACCTCCGGCGGCTTCCGCCGCCTGATCCAGATCGTCTTCGGCCTGTCCATCGCCTTCGCCG
CGTCGAGCTTCTTCCTGTCGTTCTTCTCGTTCGGCGGCGGGGCGCTCATCTGA
 Primer design