SecReT4
Protein ID: 260753593
T4SS name [ID]Trb [476]
Gene symbol-
Locus tagZa10_1362
StrainZymomonas mobilis subsp. mobilis NCIMB 11163
Repliconchromosome [GenBank: NC_013355] [Browse all T4SS(s) in this replicon]
Location [Strand]1577939..1579300 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDC8WDW6
KEGG IDzmn:Za10_1362
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.5e-54, Aligned region: 37..262
Protein Sequence: 453 a.a.     [Download]
>gi|260753593|ref|YP_003226486.1| conjugal transfer protein TrbL [Zymomonas mobilis subsp. mobilis NCIMB 11163]
MGGTGVIDNFLGVFTSYIDSGFGLLGGEVAFIATTLIVIDVTLAALFWSWGADDDIIARLVKKTLFVGVF
AYLIGNWNNLAQIIFDSFAGLGLKGSGTSFSAADLLRPGKVAQTGLDAGRPLLESISDMMGYWSFFENFI
QIACLMFAWALVLLAFFILAVQLFVTLIEFKLTTLAGFVLIPFGLFGKTAFMAERVLGNVVSSGIKVLVL
AVIIGIGSTLFSQFTAGFGGVTPTIDDAMAIVLAALSLLGLGIFGPGIASGLVSGGPQLGAGAAVGTGLA
AGGMMLAGGAAAGMAAKGGAAALSGGAAAVRGGAAAAGAASAAYSVGSLGQSGAAGVASGLGGVARAAGS
AAASPLKRTASKAAESAKSSFSDGARAGLGVTGGSSSQGTIGGASVAGAAPASAPAGGPPAWAQQMHRRQ
ALNHGTTMAAHAVRSGDSHGGGSSVNISESDRS
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|260752245|ref|NC_013355.1|:1577939-1579300 Zymomonas mobilis subsp. mobilis NCIMB 11163 chromosome, complete genome
ATGGGCGGCACCGGCGTCATCGACAACTTTCTGGGTGTTTTCACCAGTTACATCGACAGCGGCTTCGGCC
TGCTTGGCGGCGAGGTCGCCTTCATCGCCACCACGCTAATCGTCATCGACGTGACGCTGGCCGCACTCTT
CTGGTCCTGGGGTGCGGATGACGACATCATCGCCCGGCTGGTCAAGAAGACGCTCTTCGTCGGGGTCTTC
GCATACCTGATCGGCAACTGGAACAATCTCGCCCAGATCATCTTCGACAGCTTCGCCGGTCTTGGCCTGA
AAGGTTCGGGCACCAGCTTTTCCGCCGCTGATCTGCTGCGGCCCGGCAAGGTGGCGCAGACTGGCCTCGA
TGCCGGTCGCCCGCTGCTCGAATCCATCTCGGACATGATGGGTTATTGGTCGTTTTTCGAGAACTTCATC
CAGATCGCCTGCCTGATGTTCGCCTGGGCGCTGGTACTGCTGGCCTTCTTCATTCTCGCCGTGCAGCTCT
TCGTCACGCTGATCGAGTTCAAGCTGACCACGCTGGCGGGCTTTGTCCTCATCCCCTTCGGCCTCTTCGG
CAAGACCGCCTTCATGGCCGAGCGCGTTCTTGGCAATGTCGTCTCCTCCGGCATCAAGGTCCTGGTGCTG
GCCGTCATCATCGGCATCGGCTCGACATTGTTCTCGCAGTTTACGGCCGGTTTTGGCGGCGTGACGCCGA
CCATCGACGACGCCATGGCGATCGTGCTGGCCGCACTTTCCCTTCTCGGCCTCGGCATCTTCGGTCCCGG
CATCGCTTCCGGTCTTGTTTCTGGCGGCCCGCAGCTTGGCGCAGGTGCAGCAGTTGGAACCGGTCTCGCC
GCTGGCGGCATGATGCTTGCTGGCGGCGCTGCCGCAGGCATGGCCGCGAAGGGAGGGGCAGCGGCGCTGT
CGGGTGGAGCTGCTGCCGTCCGTGGCGGTGCTGCTGCCGCAGGTGCGGCGAGCGCCGCCTATAGTGTCGG
ATCGCTCGGCCAGTCAGGGGCTGCCGGTGTTGCCTCCGGCCTCGGCGGTGTTGCCCGCGCGGCAGGCTCA
GCCGCAGCATCGCCCCTGAAGCGGACGGCATCGAAAGCAGCGGAAAGCGCCAAATCCAGCTTCTCCGATG
GCGCGCGCGCCGGGCTCGGCGTCACCGGTGGATCGTCCTCGCAGGGAACCATTGGTGGTGCGAGCGTGGC
CGGTGCCGCACCCGCCTCCGCACCGGCGGGCGGACCGCCTGCATGGGCGCAGCAGATGCACCGCCGCCAG
GCGCTCAATCACGGCACGACCATGGCCGCCCATGCCGTCCGCTCCGGTGACAGCCACGGCGGCGGCTCTT
CCGTCAACATTTCCGAAAGTGACCGCTCATGA
 Primer design