SecReT4
Protein ID: 260753595
T4SS name [ID]Trb [476]
Gene symbol-
Locus tagZa10_1364
StrainZymomonas mobilis subsp. mobilis NCIMB 11163
Repliconchromosome [GenBank: NC_013355] [Browse all T4SS(s) in this replicon]
Location [Strand]1579983..1580996 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDC8WDW8
KEGG IDzmn:Za10_1364
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.8e-62, Aligned region: 104..320
Protein Sequence: 337 a.a.     [Download]
>gi|260753595|ref|YP_003226488.1| P-type conjugative transfer protein TrbG [Zymomonas mobilis subsp. mobilis NCIMB 11163]
MTIAFPRNSALPVFRKPALAALMLSATMLAGCATNKTPQFSYDANVPALPTVQATVTDDRPRPLHTPPAW
TVARGGTAAGTPAGRVENANAAARVEPRREGYYNAIQIYPWSEGALYQVYAAPGQITNIALEPGESLTGA
GPIAAGDTARWIIGDTESGSGTSRRVHILVKPSRSDISTNLVVTTDRRTYMIELRAREALYMPSVSWSYP
ALPAGQRQTVPAAPIIPVEAARNYRYGLTGDTPPWRPISVFDDGRRVYVVFPRGIVQGEMPPIFVIGSKG
ETQIVNSRVHQNILIVDRLFGAAELRLGSGKQQQTVRIVRIEQRQAAQPAKTGEQPS
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|260752245|ref|NC_013355.1|:1579983-1580996 Zymomonas mobilis subsp. mobilis NCIMB 11163 chromosome, complete genome
ATGACCATCGCGTTTCCCCGCAATTCCGCCTTGCCGGTTTTCCGTAAGCCCGCCCTCGCGGCTTTGATGC
TCTCGGCCACCATGCTGGCAGGCTGCGCCACCAACAAGACGCCGCAGTTCAGCTATGATGCCAATGTTCC
GGCTCTACCGACCGTGCAGGCCACCGTTACGGATGATCGGCCCCGACCGCTTCACACGCCGCCAGCCTGG
ACGGTTGCGCGTGGTGGGACCGCAGCGGGAACACCGGCAGGCCGGGTCGAGAACGCCAATGCCGCCGCCC
GCGTCGAACCGCGCCGCGAGGGTTACTATAACGCCATCCAGATCTATCCCTGGTCGGAAGGCGCGCTCTA
TCAGGTCTATGCAGCACCAGGACAGATCACCAATATCGCGCTGGAGCCGGGCGAAAGCCTGACCGGCGCG
GGACCGATCGCGGCGGGAGACACCGCCCGCTGGATCATTGGCGATACCGAGAGCGGGAGCGGTACGTCGC
GCCGGGTCCATATTCTCGTCAAACCATCCCGATCCGACATCTCAACCAATCTCGTGGTGACGACCGATCG
ACGCACCTATATGATCGAGCTGCGCGCCCGCGAGGCGCTCTATATGCCGTCCGTATCTTGGTCTTATCCG
GCGCTGCCTGCCGGTCAGCGCCAGACCGTTCCCGCAGCACCCATCATCCCGGTCGAGGCGGCACGCAACT
ATCGTTACGGCCTGACCGGAGATACGCCGCCATGGCGGCCGATTTCCGTCTTCGACGATGGCCGCCGTGT
CTATGTCGTTTTCCCGCGCGGCATCGTGCAGGGAGAGATGCCGCCGATCTTCGTCATCGGTTCCAAGGGC
GAGACCCAGATCGTCAATTCCCGTGTTCACCAGAACATCCTGATTGTGGATCGCCTGTTCGGCGCGGCTG
AGTTGCGTCTTGGTAGCGGCAAGCAGCAGCAGACGGTCAGGATCGTTCGCATCGAGCAAAGGCAAGCTGC
CCAGCCCGCCAAAACCGGGGAGCAACCGTCATGA
 Primer design