SecReT4
Protein ID: 261819967
T4SS name [ID]Tfc [693]
Gene symbol-
Locus tagPecwa_0642
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]682066..682716 [+]
Productlytic transglycosylase
Component typeTfc4
UniProt IDD0KGT2
KEGG IDpwa:Pecwa_0642
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 216 a.a.     [Download]
>gi|261819967|ref|YP_003258073.1| lytic transglycosylase [Pectobacterium wasabiae WPP163]
MANRSILISMLIVLGIMHSGIVSAQKRPVALQQIPAAYRQIAKDARVPAESLYSLALTESSRRLPYGERP
WPWSINVAGKTYRYETRELAWQALRQFIRQTPLKNIDVGIAQVNLGWNGHRFRSFYDAFEPFTNLRVAAR
ILRECYDAKPDSWLRAAGCYHRPAGGLPTERYMAIVRQKLKLISPVQEPLESSPPILLASSEAIIPSYQL
TWIEPE
 
Nucleotide Sequence: 651 bp     [Download]
>gi|261819370|ref|NC_013421.1|:682066-682716 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGGCAAATCGCAGCATTTTAATCAGTATGCTCATCGTACTTGGGATAATGCATAGCGGTATTGTTAGCG
CACAAAAACGTCCTGTTGCCTTGCAACAAATCCCAGCGGCATACCGACAAATTGCTAAAGATGCGCGTGT
GCCAGCTGAGTCACTTTATTCACTTGCACTAACGGAAAGCTCTCGTCGATTGCCTTACGGTGAGCGGCCA
TGGCCGTGGTCGATCAATGTTGCCGGAAAAACGTATCGGTATGAGACACGCGAATTGGCATGGCAGGCGT
TACGCCAGTTTATTCGCCAGACACCGCTAAAGAACATTGATGTTGGGATCGCTCAGGTTAATTTGGGCTG
GAACGGACATCGTTTTCGCTCTTTTTATGACGCATTTGAGCCGTTTACCAATTTACGTGTTGCTGCCCGA
ATCTTACGTGAGTGCTATGACGCAAAACCTGATAGTTGGTTACGTGCCGCAGGGTGTTATCACCGTCCTG
CCGGCGGCCTGCCAACTGAAAGGTATATGGCGATTGTGCGCCAAAAGCTGAAGCTTATTTCTCCAGTTCA
GGAACCATTAGAGTCATCACCGCCCATCCTACTTGCCTCTTCCGAAGCAATTATTCCCAGCTACCAATTA
ACATGGATAGAGCCAGAATGA
 Primer design