SecReT4
Protein ID: 261819970
T4SS name [ID]Tfc [693]
Gene symbol-
Locus tagPecwa_0645
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]683808..685919 [+]
ProductTraG-family protein
Component typeTfc6
UniProt IDD0KGT5
KEGG IDpwa:Pecwa_0645
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 6.5e-17, Aligned region: 501..631
TrwB_AAD_bind [PF10412], Evalue: 3.7e-13, Aligned region: 184..225
TrwB_AAD_bind [PF10412], Evalue: 3.7e-13, Aligned region: 497..641
AAA_10 [PF12846], Evalue: 2.7e-12, Aligned region: 188..578
T4SS-DNA_transf [PF02534], Evalue: 9.3e-08, Aligned region: 183..640
Protein Sequence: 703 a.a.     [Download]
>gi|261819970|ref|YP_003258076.1| TraG-family protein [Pectobacterium wasabiae WPP163]
MSDRYVMESLLRPAVELYTATTAWSATYICLTAPWAVALAPSVSWVTAAGFGVLALKRTRQGLQILRYRR
NIRRLPRYVMSSKQIPVSNRYLFLGRGFQWTQKHTQRLLEARRPETECYVQPSVIYRMARDLEKKLEYSL
PYLCRLTQSDTVFNPVRPLPPVGGSPIYHGVEPDESDIAYDLGERVGHSLVMGTTRVGKTRLAELLITQD
IRRGDVTIVFDPKGDADLLKRMWAEARRAGRESEFHVFHLGWPDISARYNAIGRFSRISEVASRVAGQLS
SEGNSAAFKEFAWRFVNIITRALVALGQRPDYSLILRYVTNIGDLYETYVENLLSTQAPQLWVTVENLLS
SGMLNERDLPRNMQGQANAMKVWAIETVLGSDEGKKIWDPVLDGLRSAVRYDRTYFDKIVASLLPLLEKL
TTGKTAALLAPDYTDMDDPRPIFDWQEVIRKRGIVYVGLDALSDAEVASAVGNSMFADLVSVAGYIYKFG
IGGEAPQKKIPINLHCDEFNELMGEEFIPLINKGGGAGIQVTAYTQTLSDIEARIGSSAKANQVIGNFNS
LIMLRVRENSTAELLTSQLPEVDVYTKTLVSGVTDITNPDQGSDFTSNVQDRVSNVRMPMITPADIINLP
KGQAFALLEGGRLWKIRMPLPDSANDPFMPESISRIAEYMQQNYRTGETWWTGSTLPSDSLTGSAFEPKD
EVA
 
Nucleotide Sequence: 2112 bp     [Download]
>gi|261819370|ref|NC_013421.1|:683808-685919 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGAGTGACCGTTATGTGATGGAGTCGTTGCTACGCCCTGCGGTTGAGTTATATACAGCGACAACGGCGT
GGAGTGCGACTTATATCTGTCTGACCGCTCCCTGGGCTGTTGCGCTTGCACCGTCCGTTAGTTGGGTTAC
GGCGGCTGGGTTCGGTGTGCTGGCTCTGAAACGAACACGTCAGGGGCTACAGATCCTTCGTTACCGTCGC
AATATCCGGCGACTTCCCCGTTATGTGATGAGTAGTAAACAGATCCCCGTGAGTAACCGTTATCTGTTTC
TCGGGAGGGGATTTCAGTGGACGCAGAAACATACTCAGCGGCTCCTGGAAGCTCGTCGGCCAGAGACAGA
GTGCTATGTTCAGCCATCCGTCATTTATCGTATGGCGCGTGACCTGGAGAAAAAACTTGAGTACAGCCTG
CCATATCTCTGCCGGCTTACTCAATCCGACACCGTCTTTAACCCCGTCAGACCGTTACCTCCCGTAGGGG
GAAGCCCCATCTATCACGGTGTTGAACCAGATGAATCCGATATTGCTTATGATCTTGGGGAACGTGTAGG
GCACTCGTTAGTTATGGGAACAACGCGTGTGGGTAAAACACGCCTGGCAGAATTATTGATCACGCAGGAT
ATCCGGCGTGGTGATGTCACCATCGTATTTGACCCCAAAGGAGATGCTGATCTGCTGAAACGGATGTGGG
CGGAAGCGCGGAGAGCTGGAAGGGAAAGTGAGTTTCATGTTTTCCATCTTGGCTGGCCAGATATCAGCGC
GCGTTATAACGCGATCGGGCGTTTTAGCCGAATTTCTGAAGTGGCTTCTCGTGTTGCTGGTCAGCTTTCA
AGTGAAGGTAATTCGGCTGCTTTTAAGGAGTTTGCCTGGCGATTCGTCAATATCATTACACGGGCGCTGG
TTGCCCTGGGCCAGCGGCCTGATTACAGCCTGATACTCCGTTATGTCACCAATATAGGCGACCTATACGA
AACCTATGTCGAAAATCTGTTAAGCACTCAAGCTCCACAACTGTGGGTCACGGTGGAGAACTTACTTAGC
TCAGGCATGCTCAATGAGCGGGATCTTCCCCGAAATATGCAAGGGCAAGCGAACGCGATGAAAGTGTGGG
CCATCGAGACCGTTCTTGGTAGTGATGAAGGTAAAAAAATATGGGATCCGGTTCTGGATGGATTGCGGTC
GGCCGTACGTTATGACCGGACCTATTTTGATAAAATTGTGGCGTCGTTATTGCCCTTGCTGGAAAAACTG
ACGACGGGAAAAACAGCGGCTTTACTGGCACCTGATTACACCGATATGGATGATCCTCGGCCCATCTTTG
ACTGGCAGGAAGTCATTCGAAAACGAGGAATTGTGTATGTCGGACTCGATGCGCTATCGGATGCGGAGGT
CGCCTCAGCGGTAGGAAACAGCATGTTTGCAGACCTGGTATCTGTTGCCGGGTACATCTACAAGTTTGGT
ATCGGCGGTGAAGCTCCACAGAAAAAAATCCCCATTAACCTCCACTGCGATGAGTTTAACGAACTGATGG
GTGAGGAGTTTATACCGCTCATTAACAAAGGCGGCGGCGCAGGGATTCAGGTAACTGCCTATACACAGAC
CTTGTCGGATATTGAAGCTAGGATTGGCAGTAGTGCCAAGGCCAACCAGGTGATTGGTAACTTCAACTCG
TTAATCATGCTACGGGTTAGAGAAAATAGTACAGCGGAGTTGCTGACCAGCCAACTTCCTGAAGTGGATG
TCTATACCAAGACGCTGGTTTCCGGCGTAACGGATATTACTAATCCTGACCAGGGTTCTGACTTTACCAG
TAATGTTCAGGATCGTGTCAGTAATGTCAGGATGCCAATGATTACCCCAGCTGACATTATCAACCTACCG
AAAGGGCAGGCGTTTGCATTGCTTGAGGGGGGGCGGTTGTGGAAAATCCGTATGCCATTACCTGATAGCG
CAAATGACCCGTTTATGCCGGAGAGTATCAGCCGCATTGCCGAGTACATGCAGCAGAATTACCGCACCGG
CGAAACCTGGTGGACGGGGAGTACATTGCCTTCTGATAGCCTCACAGGATCTGCCTTTGAGCCAAAAGAT
GAGGTGGCGTAA
 Primer design