SecReT4
Protein ID: 261819971
T4SS name [ID]Tfc [693]
Gene symbol-
Locus tagPecwa_0646
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]685919..686671 [+]
Productinner membrane protein
Component typeTfc8
UniProt IDD0KGT6
KEGG IDpwa:Pecwa_0646
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 2.3e-73, Aligned region: 49..247
Protein Sequence: 250 a.a.     [Download]
>gi|261819971|ref|YP_003258077.1| inner membrane protein [Pectobacterium wasabiae WPP163]
MAEQPQSSPQRQEPPKKPGLFQTLLWVWPLKVIGILLVSLLVSLLIEYIGMLFFWTNEGAEHSRQVMLTE
SGYLAEGFTQSLLMSEPVTLISGIVHQSYQWLFVDSGFISWLHQAKQMKPKDGAAQMFNWVGSWLALALW
EYLQATVYVTVIFAIRVGILVLSIPLFIMVAVTGIVDGLVRRDLRRYGAGYESSFIYHHAKRFVKPAMYG
PCMLYLSWPTAVWPNLLLLPAAVLLGIVLSIVTGAFKKYL
 
Nucleotide Sequence: 753 bp     [Download]
>gi|261819370|ref|NC_013421.1|:685919-686671 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGGCAGAGCAGCCCCAGTCATCTCCACAGCGTCAGGAGCCGCCTAAAAAGCCGGGTTTGTTTCAAACGC
TATTATGGGTTTGGCCACTGAAAGTGATTGGCATTCTGCTGGTTTCTTTGTTGGTTAGTTTGCTTATTGA
ATATATCGGCATGCTGTTTTTTTGGACTAATGAAGGCGCAGAACACAGTCGCCAGGTGATGTTGACGGAA
AGTGGTTATCTGGCTGAAGGGTTTACCCAAAGCTTATTGATGTCAGAACCGGTTACCCTCATAAGCGGCA
TTGTTCACCAATCCTATCAGTGGCTGTTTGTGGACAGCGGTTTTATCAGTTGGCTGCATCAGGCAAAACA
GATGAAGCCGAAGGATGGGGCGGCGCAAATGTTTAATTGGGTTGGGAGTTGGCTGGCTCTTGCGTTGTGG
GAATACTTACAGGCGACGGTTTATGTCACGGTCATTTTTGCGATACGGGTTGGCATTCTGGTGCTATCGA
TACCGCTTTTTATCATGGTTGCGGTGACAGGGATCGTTGATGGTCTAGTTCGTCGGGACTTACGGCGCTA
CGGTGCTGGGTACGAATCCAGTTTTATCTATCATCATGCGAAGCGGTTTGTGAAGCCTGCTATGTATGGC
CCTTGTATGCTGTATTTGTCCTGGCCAACTGCGGTGTGGCCTAATCTGTTACTCTTACCCGCTGCGGTTT
TGTTGGGTATTGTGCTGTCGATCGTTACTGGTGCTTTTAAGAAGTATCTATAA
 Primer design