SecReT4
Protein ID: 261819977
T4SS name [ID]Tfc [693]
Gene symbol-
Locus tagPecwa_0652
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]694946..695254 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDD0KGU2
KEGG IDpwa:Pecwa_0652
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 1.7e-28, Aligned region: 17..96
Protein Sequence: 102 a.a.     [Download]
>gi|261819977|ref|YP_003258083.1| hypothetical protein Pecwa_0652 [Pectobacterium wasabiae WPP163]
MCRFIGLSVLLASVCVVQAHASEKDELALVMRQLDQVQAGLDRARVVANQNGQDARFYFDYGSASRDISA
MRKGIEQYLEPSRAQPSVPLSVSGQYRQERGQ
 
Nucleotide Sequence: 309 bp     [Download]
>gi|261819370|ref|NC_013421.1|:694946-695254 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGTGCCGATTTATTGGACTGAGTGTACTGCTGGCTTCGGTTTGCGTAGTTCAGGCCCATGCTTCCGAAA
AAGACGAACTTGCTCTGGTTATGCGTCAACTTGACCAGGTTCAGGCTGGATTAGATCGTGCTCGAGTAGT
TGCCAATCAGAATGGTCAGGATGCGCGCTTTTATTTTGACTACGGCAGTGCTTCCCGAGACATATCCGCT
ATGCGGAAGGGTATTGAGCAATACCTTGAGCCCTCTCGTGCCCAACCTTCGGTACCGCTTTCCGTTAGTG
GGCAATACCGCCAGGAGAGAGGGCAATGA
 Primer design