SecReT4
Protein ID: 261819980
T4SS name [ID]Tfc [693]
Gene symbol-
Locus tagPecwa_0655
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]695887..696261 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDD0KGU5
KEGG IDpwa:Pecwa_0655
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 2.2e-35, Aligned region: 3..117
Protein Sequence: 124 a.a.     [Download]
>gi|261819980|ref|YP_003258086.1| hypothetical protein Pecwa_0655 [Pectobacterium wasabiae WPP163]
MAVIEFLPDRLNVAPVVYRGFTTGELGLAAGLGVALGIPLAFPLAFVPFIGWIAFPTCMLITPLFVVFLG
GKWISSFKRGKPENYLWRRLDELKATWGMSRGLILISRSWELKRTRSVFQRGRS
 
Nucleotide Sequence: 375 bp     [Download]
>gi|261819370|ref|NC_013421.1|:695887-696261 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGGCCGTGATTGAGTTTCTCCCCGATCGTTTGAATGTTGCTCCTGTGGTTTATCGTGGATTCACTACAG
GGGAGCTAGGACTGGCTGCGGGATTGGGTGTTGCATTGGGAATACCGCTGGCGTTTCCACTGGCATTTGT
CCCTTTTATTGGTTGGATTGCTTTTCCTACCTGCATGCTGATAACCCCGTTATTTGTAGTGTTTCTTGGT
GGTAAATGGATCAGTTCGTTTAAACGAGGGAAACCCGAAAATTATCTTTGGCGGCGGCTGGATGAGCTTA
AAGCGACATGGGGCATGAGTCGCGGCCTGATTCTGATTTCCCGCTCATGGGAATTGAAGCGTACTCGTTC
CGTTTTTCAGAGGGGTAGATCATGA
 Primer design