SecReT4
Protein ID: 261820002
T4SS name [ID]Tfc [693]
Gene symbol-
Locus tagPecwa_0680
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]720255..721682 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDD0KGW7
KEGG IDpwa:Pecwa_0680
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 475 a.a.     [Download]
>gi|261820002|ref|YP_003258108.1| hypothetical protein Pecwa_0680 [Pectobacterium wasabiae WPP163]
MKTKQTRYSPSVSILSGILAITILGTATHVGAEINTSPSGASVSGAVSDGLFYSIGGGTVISPPSSRNSM
TRLGVTGGWSSDLMCGNFDMKTTVGNQLNGITSGFKDLMGTVIQGATGAVASMPAMVIQRANPALYEMLT
NGVLQAGLSFDKAKLSCQSMANKMADYTVGNKWTQAAVVEEYKDIVASSNGDAVSSDQKLQKATGEEGAT
WIGGQKRGGKGQAAIRPTRDLAKAGFNMMNNLPVTSNSSVSSSSCNGTSCQRFPSSEKAAEAVVKVLGDR
SIRTCRDASQCSSGGVENEPGSSVAGTGFSPMLEEATKENTEQLVKLVGGAEAPTASNLAKLKTGSMVVT
RSVIQSLKDDPDNSALIQRLAGELAMSDTVETALTMRRMLTTGQSEPNAADQPEALSEGDRRIDALDREL
AALKNEMDIRKAISNNSLLTTLERQGVRNQGNRFQQKSGSQDQGFNGLSQNQGGQ
 
Nucleotide Sequence: 1428 bp     [Download]
>gi|261819370|ref|NC_013421.1|:720255-721682 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGAAAACAAAGCAAACGCGCTATTCCCCGTCCGTCTCTATTTTATCCGGCATTCTGGCCATCACGATCC
TCGGCACAGCAACTCATGTGGGAGCTGAAATTAATACTTCACCCTCCGGGGCATCTGTCAGCGGTGCGGT
CAGTGACGGGCTGTTCTATTCGATCGGTGGCGGTACGGTGATATCACCTCCGTCATCACGAAACAGCATG
ACGCGTCTGGGCGTTACCGGTGGTTGGAGCAGCGACCTGATGTGCGGCAATTTCGATATGAAAACGACAG
TCGGTAATCAGCTTAACGGTATTACCAGTGGCTTTAAGGATCTGATGGGAACCGTGATTCAGGGGGCTAC
CGGTGCTGTGGCCAGTATGCCGGCGATGGTCATCCAGCGTGCCAATCCTGCGCTGTATGAAATGCTGACC
AATGGTGTGTTGCAGGCAGGACTCAGCTTTGACAAGGCCAAGCTGAGTTGCCAGAGCATGGCCAACAAAA
TGGCCGATTATACCGTGGGTAATAAATGGACTCAGGCTGCAGTTGTGGAGGAATACAAGGATATTGTGGC
ATCCAGTAACGGCGATGCAGTCAGTAGCGACCAGAAGTTGCAGAAAGCGACAGGGGAAGAAGGGGCCACC
TGGATTGGTGGCCAAAAACGCGGTGGAAAGGGACAGGCAGCTATCAGGCCCACCCGGGATTTGGCGAAAG
CCGGCTTCAATATGATGAATAACCTGCCAGTGACGAGTAACAGCAGTGTCAGCTCATCAAGCTGCAACGG
TACATCATGCCAGCGTTTCCCTTCTTCTGAAAAAGCGGCTGAAGCGGTAGTCAAGGTACTCGGCGATCGC
TCGATTCGTACCTGCCGGGATGCCAGTCAGTGTTCAAGTGGCGGCGTGGAGAACGAACCTGGGAGCAGTG
TTGCCGGCACGGGATTCTCCCCAATGCTGGAAGAAGCAACAAAAGAAAATACGGAGCAGTTGGTAAAACT
GGTTGGCGGTGCTGAAGCGCCGACGGCCAGCAATTTGGCCAAGCTCAAAACAGGCAGCATGGTTGTGACG
CGTAGCGTTATCCAGTCCCTGAAAGATGATCCGGACAATAGCGCACTCATTCAGCGTTTAGCCGGTGAAC
TGGCGATGTCGGATACCGTTGAAACCGCACTGACGATGCGCAGGATGCTGACTACGGGACAATCCGAACC
GAATGCAGCCGATCAACCTGAAGCGCTGTCTGAAGGTGACCGGCGTATTGATGCTCTGGACAGGGAGTTG
GCTGCATTGAAAAATGAAATGGATATCCGTAAAGCCATCAGTAACAACAGCTTGCTGACCACGCTGGAAC
GTCAGGGAGTACGTAATCAAGGCAACCGGTTCCAGCAAAAGAGTGGGAGCCAGGATCAAGGCTTTAACGG
ATTGAGCCAGAATCAGGGAGGGCAGTAA
 Primer design