SecReT4
Protein ID: 261820909
T4SS name [ID]Tfc [694]
Gene symbol-
Locus tagPecwa_1618
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]1758243..1759760 [-]
Producthypothetical protein
Component typeTfc19
UniProt IDD0KM47
KEGG IDpwa:Pecwa_1618
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.5e-126, Aligned region: 10..489
Protein Sequence: 505 a.a.     [Download]
>gi|261820909|ref|YP_003259015.1| hypothetical protein Pecwa_1618 [Pectobacterium wasabiae WPP163]
MTLFTTDYLEYYLTLVSWVVHNGIWAVLVSSGVFALPFVAIIIDEWLRSRTEGADEGNKGLLSSMRIENR
VWVAIVVVMFAGIPFIDVDLDTIRYDQARSAQCQISVPQPEDTGWSQSFSTLNNQSAKVPVWWAFMHALS
RAITGASVAAIPCGTDLRQMRMEINATRIDNPLLAQEVADFTHDCYGPARAKLFMSRPDLDEAQMHDVTW
IGSTYFVSTGGFYDTYRAKTPREGWAYDSNRDAGLAQVPSGAGYPSCRQWWSDGSNGLRARLLAQVDPSL
LSRIANWAGFISRAEVDDSVIRALASPRQQKLNQGSVYTDYGGQIEKTLPNIVTRAAGDIGMTIGGIAAF
PALDVVRQALPMVLALLKMALVICIPLVLLVGTYDLKTVVTLSIVQFALFFVDFWFQLARWLDSTILDAL
YGWGWGWNRPHNNVDPLVGMHNTFGDMLLNFVMGSMFIVLPAFWVGALAWAGIRAGTIANSFSAGTKDAG
NAGGKGAGTVSKKLR
 
Nucleotide Sequence: 1518 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c1759760-1758243 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGACGCTTTTCACTACCGATTATCTGGAGTATTACCTGACCCTGGTGAGCTGGGTCGTCCACAACGGTA
TTTGGGCTGTACTGGTTTCCAGCGGCGTGTTCGCCCTCCCCTTCGTGGCCATCATCATCGACGAGTGGCT
GAGATCCCGTACTGAAGGTGCCGACGAAGGCAACAAGGGCCTACTGTCTTCAATGCGTATTGAAAACCGG
GTATGGGTGGCAATCGTGGTGGTGATGTTCGCGGGTATTCCGTTCATTGATGTTGACCTCGACACGATCA
GGTACGATCAGGCGCGTTCGGCACAGTGCCAGATCAGCGTGCCCCAGCCCGAAGACACGGGCTGGTCGCA
ATCATTCAGCACCCTCAACAACCAGAGTGCAAAAGTGCCAGTCTGGTGGGCCTTCATGCATGCGCTCTCA
CGCGCGATCACGGGTGCCTCGGTGGCGGCTATCCCATGCGGCACCGACCTGCGACAAATGCGGATGGAGA
TCAATGCCACCCGGATTGACAATCCCCTACTGGCTCAGGAAGTCGCAGACTTTACCCACGACTGCTACGG
CCCTGCACGCGCCAAACTGTTCATGAGCCGTCCTGATCTTGATGAAGCACAAATGCACGACGTGACCTGG
ATCGGCTCGACCTATTTTGTCAGCACCGGCGGCTTCTATGACACCTACCGCGCCAAGACACCACGTGAGG
GCTGGGCTTACGACAGCAATCGTGACGCTGGACTGGCTCAGGTGCCAAGCGGTGCGGGCTACCCAAGTTG
TCGCCAGTGGTGGAGCGATGGTAGCAACGGTTTACGCGCGCGCCTGCTGGCACAGGTCGATCCCAGCCTA
CTCAGTCGCATCGCCAACTGGGCGGGATTCATCAGCCGTGCAGAGGTAGATGACTCGGTGATTAGGGCGC
TTGCTTCTCCCCGCCAGCAAAAACTCAATCAAGGCAGCGTTTACACCGATTATGGCGGTCAAATCGAAAA
AACCTTACCGAATATTGTCACACGTGCTGCAGGCGACATCGGCATGACCATTGGAGGGATCGCCGCATTC
CCGGCATTGGACGTCGTGCGCCAGGCACTGCCGATGGTGCTTGCACTACTGAAGATGGCGCTGGTGATCT
GTATCCCTCTGGTGCTCCTGGTCGGCACCTACGACCTGAAGACCGTTGTCACGCTCAGCATCGTGCAATT
TGCGCTGTTCTTTGTGGATTTCTGGTTCCAGCTTGCACGCTGGCTCGACAGTACGATCCTCGATGCGCTT
TACGGATGGGGATGGGGCTGGAATCGGCCGCATAACAATGTTGATCCGCTTGTAGGCATGCACAATACCT
TCGGAGACATGTTGCTGAACTTCGTTATGGGCTCGATGTTCATTGTGCTCCCGGCATTCTGGGTCGGTGC
GCTGGCCTGGGCGGGCATTCGGGCGGGGACAATCGCAAATAGTTTTTCAGCGGGCACAAAGGATGCTGGT
AATGCTGGCGGAAAGGGGGCGGGTACGGTCTCCAAAAAACTCAGGTAG
 Primer design