SecReT4
Protein ID: 261820911
T4SS name [ID]Tfc [694]
Gene symbol-
Locus tagPecwa_1620
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]1760110..1761510 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDD0KM49
KEGG IDpwa:Pecwa_1620
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 466 a.a.     [Download]
>gi|261820911|ref|YP_003259017.1| hypothetical protein Pecwa_1620 [Pectobacterium wasabiae WPP163]
MMKRLDPKAFSILVPRLWQPTLWVAALTLSSGLALAQDGGFQNSGAVIGDEVMYSIGGGNAVSMSGAAGM
RSIGVGVGWNSNLICGDMNISTTIQNQLNGLTNGFQNIMGNVIQNATSAVASLPALIIQRADPGLYNLLT
NGVLQARLDFDRSKLTCRAMAEKMADTAGGQLGWSQIAEGMALRQAVGSSDAVSAIEQAEKNRGNAGVPW
VGGSNAGGTGQRSIKVVGDVTRAGYNLVNGRGVTDTAPIDPANCQSLSCQTWASPQQAIDFATRVLGEQE
QRTCEGCTKTETLPGVGLTPVIQDEYDAKLEALQELVSGARHTTFENLRKAGSTSLPITRGVIEALRDEP
DQDILARRLASEVALASVLEKALLLQRTLLTGRKEPNVAANQLAVAAVDQESNTLDREILNLKTELELRR
ELANNSPMAIIQRHSARAAGSRGIYEGDPEPNRLDQLQRPNPGGTP
 
Nucleotide Sequence: 1401 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c1761510-1760110 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGATGAAACGTCTCGACCCGAAAGCGTTTTCAATTCTTGTGCCGCGCCTGTGGCAACCCACGCTATGGG
TTGCTGCACTGACGCTGAGCAGTGGTCTGGCTCTGGCACAGGACGGAGGCTTCCAGAACAGCGGAGCCGT
CATTGGTGATGAAGTGATGTACTCCATCGGCGGCGGTAACGCCGTATCAATGAGCGGTGCGGCCGGCATG
CGCTCGATTGGTGTCGGTGTAGGCTGGAACAGCAACCTGATCTGCGGTGACATGAACATCAGTACCACCA
TCCAGAATCAGCTCAATGGGCTGACCAACGGCTTTCAGAACATCATGGGCAACGTGATCCAGAACGCCAC
CAGCGCCGTCGCCTCGTTGCCCGCACTGATCATCCAGCGGGCCGATCCGGGCCTCTATAACCTGCTGACC
AATGGCGTTCTGCAAGCCCGACTCGACTTTGATCGCTCCAAACTCACCTGCCGAGCGATGGCTGAAAAAA
TGGCAGATACCGCAGGCGGCCAGCTTGGCTGGAGCCAGATCGCCGAAGGCATGGCGCTGCGTCAGGCCGT
CGGCAGCAGCGACGCTGTTTCAGCCATTGAACAGGCCGAAAAAAACCGGGGTAACGCCGGCGTACCGTGG
GTGGGTGGCAGCAATGCCGGCGGTACAGGTCAGCGCTCAATCAAGGTCGTCGGGGACGTAACCCGTGCAG
GCTACAATCTGGTCAATGGCCGTGGGGTAACCGACACCGCCCCCATCGACCCGGCAAATTGCCAAAGCCT
GTCCTGCCAGACGTGGGCATCTCCCCAACAAGCCATCGACTTTGCCACGCGTGTGCTGGGCGAACAGGAA
CAACGCACCTGCGAAGGCTGCACCAAGACCGAGACCTTGCCTGGCGTCGGATTGACCCCGGTCATCCAGG
ACGAATACGACGCCAAACTGGAAGCGCTGCAAGAGCTGGTCAGCGGAGCACGCCACACCACGTTCGAGAA
CCTTCGCAAGGCTGGCAGTACCTCACTACCCATCACCCGTGGCGTGATCGAGGCACTGCGTGACGAACCT
GATCAAGACATCCTGGCCCGACGTCTGGCCTCCGAAGTCGCGCTGGCATCGGTACTGGAAAAAGCCCTGC
TGCTGCAACGTACGCTACTGACCGGCAGGAAAGAGCCAAACGTCGCCGCCAACCAATTGGCAGTCGCCGC
CGTCGATCAGGAAAGCAACACGCTTGACCGCGAGATCCTCAATCTCAAAACCGAGCTTGAACTACGCCGC
GAACTCGCCAACAACTCGCCGATGGCCATCATCCAGCGCCACAGCGCACGCGCGGCAGGCTCACGCGGCA
TTTATGAAGGTGATCCCGAACCTAACCGTCTTGACCAGTTGCAACGCCCCAACCCCGGAGGCACGCCATG
A
 Primer design