SecReT4
Protein ID: 261820912
T4SS name [ID]Tfc [694]
Gene symbol-
Locus tagPecwa_1621
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]1761518..1762453 [-]
Producthypothetical protein
Component typeTfc23
UniProt IDD0KM50
KEGG IDpwa:Pecwa_1621
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 5e-97, Aligned region: 29..299
Protein Sequence: 311 a.a.     [Download]
>gi|261820912|ref|YP_003259018.1| hypothetical protein Pecwa_1621 [Pectobacterium wasabiae WPP163]
MRLPRRLRVSLATVLLTAASSSFALNTAAIISSSLSPDCLEYRVTGICYWLLCTKFGCTVRTSVKVRHYV
PDAVVSSYANTGENPWLEVRAMSQTNTTARSGGDGTSNHGNENNLSSFRNADVIGHPGGQVFNQFAASSG
TICDGAGTAFMPYLLSTLDTIAWRYNIPESVYPEALIPGMREIGARTALNLWGNVYPRGGFLHQVDSYKA
SAVVAQRAGDIVTRRGQLHVYQPLLANARDGYWPAGALMESDAATGKWQELAPRSSSSCTVFPHNGTHTQ
AQQDNYAWALWRPYSCCQRRGQTFLGSVDFN
 
Nucleotide Sequence: 936 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c1762453-1761518 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGAGACTCCCCCGCCGCCTGCGCGTCAGTCTTGCCACCGTTTTGCTCACGGCAGCCAGTTCCTCGTTTG
CCCTCAACACCGCTGCCATCATCTCCTCATCATTATCCCCTGATTGCCTGGAATACCGGGTCACCGGGAT
CTGCTACTGGCTGCTTTGCACCAAGTTCGGATGTACGGTTCGAACCTCCGTCAAAGTCAGACACTACGTC
CCCGACGCCGTAGTGTCGAGCTACGCTAACACCGGGGAAAATCCATGGCTTGAAGTACGCGCCATGAGCC
AAACCAACACCACGGCCCGGAGCGGTGGTGACGGCACCAGTAACCATGGCAACGAGAACAATCTCTCCAG
TTTCCGTAACGCAGACGTGATCGGCCACCCCGGCGGCCAGGTGTTCAATCAGTTTGCCGCATCATCAGGC
ACCATCTGCGATGGTGCTGGCACCGCCTTCATGCCGTACCTGTTGAGCACTCTCGATACCATCGCGTGGC
GCTACAACATCCCTGAATCGGTGTACCCCGAGGCGCTGATCCCCGGTATGCGCGAGATCGGCGCACGCAC
CGCACTGAACCTGTGGGGCAACGTCTATCCACGCGGCGGTTTCCTGCATCAGGTGGACAGCTACAAGGCC
AGCGCCGTGGTCGCCCAGCGGGCGGGCGATATCGTGACCCGCAGAGGGCAACTGCACGTATACCAACCCC
TGCTCGCCAACGCACGCGACGGTTACTGGCCGGCAGGCGCACTGATGGAAAGCGATGCTGCCACCGGCAA
ATGGCAAGAATTGGCCCCTCGTTCCTCCTCTTCCTGCACGGTCTTCCCACACAACGGAACGCACACTCAG
GCACAGCAAGACAACTACGCCTGGGCACTCTGGCGACCTTATAGCTGCTGCCAGCGACGCGGCCAGACCT
TTCTTGGCAGCGTAGATTTCAACTGA
 Primer design