SecReT4
Protein ID: 261820913
T4SS name [ID]Tfc [694]
Gene symbol-
Locus tagPecwa_1622
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]1762450..1762884 [-]
Producthypothetical protein
Component typeTfc24
UniProt IDD0KM51
KEGG IDpwa:Pecwa_1622
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 1.2e-37, Aligned region: 31..142
Protein Sequence: 144 a.a.     [Download]
>gi|261820913|ref|YP_003259019.1| hypothetical protein Pecwa_1622 [Pectobacterium wasabiae WPP163]
MLALASTSSFWWHTLAIVMLTALLSPLAQAADVIVVTDTRHPVQNRGNTRLIELDGPSRIEAELAANLPQ
DPARAAIIVQQRLREGGTALQQRINEAYQDVVDAWSLGITTLPAVIVDQRYVVYGEPDVAKAVARINTYR
RTQP
 
Nucleotide Sequence: 435 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c1762884-1762450 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGCTGGCTCTCGCTTCAACCTCTTCATTCTGGTGGCATACGCTTGCCATCGTCATGCTGACTGCCCTGT
TGAGCCCGCTGGCGCAGGCCGCAGATGTAATTGTCGTCACCGACACACGACACCCAGTTCAGAACCGGGG
TAATACCCGGCTCATCGAACTGGACGGCCCCTCACGCATTGAGGCAGAACTAGCAGCCAACCTTCCCCAA
GACCCGGCACGCGCCGCCATCATCGTGCAACAACGCCTGAGAGAAGGCGGCACAGCGCTGCAGCAACGCA
TCAACGAGGCCTATCAGGATGTTGTCGATGCCTGGAGCCTGGGCATTACCACCCTTCCGGCCGTCATCGT
CGATCAACGCTATGTGGTTTATGGTGAACCTGACGTCGCCAAAGCAGTGGCGCGTATCAACACATACAGG
AGGACTCAGCCATGA
 Primer design