SecReT4
Protein ID: 261820917
T4SS name [ID]Tfc [694]
Gene symbol-
Locus tagPecwa_1626
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]1765585..1768434 [-]
Producthypothetical protein
Component typeTfc16
UniProt IDD0KM55
KEGG IDpwa:Pecwa_1626
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 6.7e-69, Aligned region: 59..334
AAA_10 [PF12846], Evalue: 5.9e-46, Aligned region: 527..864
Protein Sequence: 949 a.a.     [Download]
>gi|261820917|ref|YP_003259023.1| hypothetical protein Pecwa_1626 [Pectobacterium wasabiae WPP163]
MVWSLPWRKPTVPTKGEQPDGWQRHIDTLQQAGIPEPGTSVRGSRPATQADEQALYEVAPSFVALLPWVE
YLPESQSMLLEDGVSVAAFFELTPLGTEGREPVWLAQARDALENALQDSFDELDDNPWVLQLYAQDETNF
DQYLQTLKGYIQPRAQHSRFTEFYLHSMAHHLRAVAKPGGLFEDTTVTRLPWRGQTRRVRMIVYRRTAGS
TTRRGQTPEQALSVVCDRLSGGLANAGIRAQRLDASHIHNWLLRWFNPHPTLLGHSAEDCERFYQLTAYP
DTHDLDEIELASGCDFSQRLFFGQPRSDTARGEWHFDGMPHRVMTTDRLRAPPSVGHMTGENRKGDAINT
LFDQMPEDTMMCLTLVATPQDVLETHLNHLAKKAVGETLASEQTLADVQEARSLIGSAHKLYRASLAFYL
RGKDEEELDSRGLQLANVMLGAGLQPVREEDEVAPLNTYLRWLPCMYNPAQDRKQWYTQMMFAQHVANLS
PTWGRSRGTGHPGITVFNRGGGLITFDPFNRLDRQMNAHLFLFGPTGSGKSATLNNLLNQVTAIYRPRIF
IVEAGNSFGLFCEFARRLGLTVNRVKLAPGAGVSLAPFADARRLIETPSDVQTLDADELDDEPQSKEAEA
DEQRDVLGELEITARLMITGGEDKEEARMTRADRSLIRQCILDAAQRCVAANRTVLTRDVRDALRERGHD
TTLPEIRRARLLEMADAMDMFCQGSDGEMFDRDGTPWPEADITLVDLATYAREGYNAQLSIAYISLINTV
NNIAERDQFLGRPILNVTDEGHIITKNPLLSPYVVKVTKMWRKLGAWFWLATQNIDDLPKAAEPMLNMIE
WWICLSMPPDEVEKIAKFRELTPAQKALMLSARKESGKFTEGVILSKSLEVLFRAVPPSLYLALAQTEPE
EKAERYQLMQQLGIGELDAAFKVAEMIDHARGITPMAQR
 
Nucleotide Sequence: 2850 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c1768434-1765585 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGGTCTGGTCGCTTCCCTGGCGCAAGCCCACTGTGCCGACCAAAGGCGAACAGCCGGACGGCTGGCAGC
GCCACATCGATACACTACAGCAGGCAGGCATTCCCGAACCCGGTACCAGCGTAAGGGGGAGCCGTCCCGC
TACCCAGGCCGATGAGCAGGCCTTGTACGAGGTGGCCCCATCGTTTGTCGCGTTGCTGCCCTGGGTTGAA
TATTTGCCCGAATCACAAAGTATGCTGCTGGAGGATGGTGTCTCAGTCGCCGCCTTCTTTGAACTGACCC
CGCTGGGTACAGAAGGCCGTGAGCCGGTCTGGCTGGCCCAGGCACGGGATGCGCTGGAAAACGCGCTGCA
GGACAGCTTCGACGAGCTCGACGACAATCCCTGGGTACTGCAACTCTACGCTCAGGACGAGACCAACTTT
GATCAGTATCTGCAGACCCTCAAGGGCTACATCCAGCCACGTGCGCAGCACTCACGCTTCACCGAATTCT
ATCTGCATTCGATGGCCCATCACCTGCGCGCAGTAGCAAAGCCGGGAGGCCTGTTCGAGGATACGACAGT
CACGCGTCTGCCCTGGCGAGGGCAAACACGACGGGTACGCATGATCGTCTATCGCCGCACCGCAGGCAGC
ACGACCCGACGCGGCCAGACGCCCGAGCAGGCATTGAGTGTGGTCTGTGATCGCCTGAGCGGTGGTCTGG
CCAACGCAGGCATCCGCGCACAGCGTCTGGATGCATCGCACATCCACAACTGGCTGCTGCGCTGGTTCAA
CCCACATCCCACGCTGCTGGGCCACAGCGCCGAAGACTGCGAACGTTTCTACCAGTTGACCGCCTACCCG
GACACCCACGACCTCGACGAAATCGAGCTGGCCTCCGGGTGCGATTTCAGCCAGAGGCTGTTCTTCGGCC
AGCCACGTTCAGATACGGCCCGGGGCGAGTGGCACTTTGACGGCATGCCGCATCGGGTGATGACGACCGA
CCGCCTGCGCGCACCGCCCAGTGTAGGTCATATGACAGGCGAGAATCGCAAAGGCGACGCCATCAACACC
TTGTTCGACCAGATGCCGGAAGACACGATGATGTGCCTGACACTGGTTGCCACACCACAGGACGTACTCG
AAACACACCTGAATCATCTGGCAAAGAAAGCCGTTGGCGAAACGCTGGCCTCCGAACAAACCCTGGCGGA
TGTGCAAGAGGCGCGCTCACTGATCGGCAGCGCCCACAAACTATACCGTGCCAGCCTGGCCTTTTACCTT
CGTGGCAAGGATGAAGAAGAACTCGACAGCCGGGGACTGCAACTGGCCAACGTGATGCTGGGCGCAGGCC
TGCAGCCGGTACGCGAAGAGGACGAGGTCGCGCCGCTCAACACCTACCTGCGCTGGCTGCCGTGTATGTA
CAACCCGGCCCAGGACCGCAAACAGTGGTACACACAAATGATGTTCGCCCAGCATGTGGCCAACCTCTCA
CCGACCTGGGGACGTAGCCGGGGTACAGGTCACCCGGGGATCACTGTCTTCAATCGCGGTGGAGGCCTGA
TCACGTTTGATCCCTTCAACCGCCTGGATCGGCAGATGAACGCGCACCTTTTCCTGTTCGGCCCTACAGG
TTCGGGCAAGAGCGCCACCCTCAACAACCTGCTCAATCAGGTCACCGCCATCTATCGTCCACGGATCTTC
ATTGTGGAGGCTGGCAATTCCTTCGGGCTGTTCTGCGAGTTCGCCCGGCGTTTAGGGCTGACTGTCAACC
GTGTCAAGCTCGCTCCGGGTGCGGGCGTCAGTCTCGCACCGTTCGCCGATGCCCGCAGACTCATCGAAAC
CCCCAGTGATGTACAAACACTCGATGCCGATGAACTCGATGACGAGCCACAGAGCAAGGAAGCCGAGGCC
GACGAACAACGCGATGTGCTGGGCGAACTGGAGATCACGGCACGCCTGATGATCACGGGGGGTGAAGACA
AGGAAGAAGCCCGCATGACCCGCGCCGATCGCTCGTTGATCCGCCAATGCATTCTGGACGCCGCTCAGCG
CTGCGTCGCTGCGAACCGTACCGTGCTGACCCGTGACGTGCGCGATGCACTACGTGAACGGGGTCATGAC
ACGACGCTGCCGGAAATCCGGCGCGCTCGCCTGCTGGAGATGGCCGACGCGATGGATATGTTCTGCCAGG
GCAGCGATGGTGAAATGTTCGACCGTGACGGAACGCCCTGGCCCGAGGCCGACATCACCCTGGTCGACCT
GGCAACCTATGCACGCGAAGGCTACAACGCACAACTGTCGATCGCCTACATCTCGCTTATCAACACCGTC
AACAACATCGCCGAGCGCGACCAGTTCCTGGGCCGCCCCATCCTCAACGTGACGGACGAAGGCCATATCA
TCACCAAAAACCCCTTGCTCTCGCCCTACGTCGTGAAGGTCACGAAAATGTGGCGCAAGCTGGGTGCGTG
GTTTTGGCTCGCGACACAGAACATCGACGACCTGCCGAAGGCCGCAGAACCCATGCTCAACATGATCGAA
TGGTGGATTTGCCTGTCGATGCCACCCGACGAGGTGGAAAAAATCGCAAAGTTCAGGGAACTGACACCCG
CGCAGAAAGCGCTGATGCTGTCCGCACGCAAAGAATCCGGAAAATTCACCGAAGGCGTCATCCTCTCCAA
GAGCCTGGAAGTGCTCTTCCGTGCCGTACCGCCCAGCCTCTATCTCGCCTTGGCGCAGACCGAACCCGAG
GAAAAAGCCGAACGCTACCAACTGATGCAGCAGCTCGGGATTGGGGAGTTGGATGCGGCGTTCAAAGTGG
CCGAAATGATTGATCATGCACGTGGTATCACGCCCATGGCGCAAAGGTAA
 Primer design