SecReT4
Protein ID: 261820918
T4SS name [ID]Tfc [694]
Gene symbol-
Locus tagPecwa_1627
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]1768434..1768871 [-]
Productsecreted protein
Component typeTfc15
UniProt IDD0KM56
KEGG IDpwa:Pecwa_1627
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 145 a.a.     [Download]
>gi|261820918|ref|YP_003259024.1| secreted protein [Pectobacterium wasabiae WPP163]
MRSNWTKPLAIMLSVSVLTGCATSKEDVLPHGGRTMQDIWQQESGNGGRVGQMAYRQLLDARQSLRRPLS
HADGQAAPAEQAHYTRTAANEVRSQFQRLPNPDLLMYVFPHLAGTDPVPVPGYTTIFPLYQRVQYAMPGE
RTEDY
 
Nucleotide Sequence: 438 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c1768871-1768434 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGCGCTCGAACTGGACTAAACCGCTGGCAATCATGCTATCCGTGAGCGTATTGACCGGCTGCGCCACGA
GCAAGGAAGACGTGTTACCCCATGGGGGTCGAACCATGCAGGACATCTGGCAGCAAGAGAGCGGCAATGG
AGGCCGAGTGGGACAGATGGCCTATCGCCAACTGCTCGATGCCCGTCAGAGCTTGCGCCGTCCACTCAGC
CATGCGGATGGGCAAGCTGCTCCTGCAGAACAGGCACACTACACGCGTACCGCCGCCAATGAAGTACGCA
GCCAGTTCCAGCGACTGCCCAACCCCGACCTGCTGATGTACGTGTTCCCGCATCTGGCGGGGACAGACCC
GGTTCCTGTACCGGGTTACACCACCATCTTCCCCCTCTACCAGCGTGTGCAATACGCAATGCCGGGCGAA
CGTACGGAGGACTACTGA
 Primer design