SecReT4
Protein ID: 261820919
T4SS name [ID]Tfc [694]
Gene symbol-
Locus tagPecwa_1628
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]1768852..1770258 [-]
Productsecreted protein
Component typeTfc14
UniProt IDD0KM57
KEGG IDpwa:Pecwa_1628
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 468 a.a.     [Download]
>gi|261820919|ref|YP_003259025.1| secreted protein [Pectobacterium wasabiae WPP163]
MRSNGLLKWLMIPVALLVLFVGIRLFSGGGTQSPATAETGSQLTPEEMKALGIEGDTPRDTVATLVAQVR
QLRTELQTATTDNRAQREENQRLRQRESAIDQRISTTLESERASLRRDQEQLNNERQQTEGLLADLQRRL
DSIGNAGHGDLPVGLGLRDGDVEGFSDETTIRWVEPDDAKQTDGRHGNAALSFPTRFGPAQKTLDTTVES
VTSTRTNATRANPARAVYTVPTNSTLMGSVAMTALIGRVPIDGTVNDPYPFKVLVGPDNLTANGIDIPDV
AGAVFSGTASGDWTLSCVRGQVRSITFVFHDGTIRTLPEDSERSHQQSNDQNGLGWISDPYGIPCVSGER
RSNAQQYLGTQALITAAGAGAASLIDSDSGQMSYAGADGSLGTVGISSNEAVGRILAGGVRDMSDWVNKL
YGQAFAAVYVKPGAHVAVHLEKPLAIDYDTEGRKVDHRTGESHALELD
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c1770258-1768852 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGCGCAGTAACGGTCTGTTGAAATGGCTGATGATCCCCGTCGCACTGCTGGTCCTGTTCGTTGGCATCC
GCCTGTTCTCTGGTGGCGGCACACAGTCCCCTGCCACGGCAGAGACGGGCAGCCAGCTCACCCCGGAGGA
AATGAAGGCGTTGGGCATCGAAGGAGACACGCCACGCGATACTGTCGCGACGCTGGTGGCCCAGGTTCGG
CAACTGCGCACTGAGCTACAAACCGCCACCACCGACAACCGGGCACAACGAGAAGAAAACCAGCGTCTGC
GTCAACGTGAAAGTGCCATTGACCAGCGTATCAGTACCACACTGGAATCCGAGCGGGCCAGCCTTCGCCG
CGACCAGGAGCAACTCAACAACGAGCGCCAACAAACTGAGGGCCTGCTGGCAGATTTGCAACGGCGGCTG
GACAGTATCGGTAACGCCGGTCACGGCGACCTGCCAGTCGGCCTTGGCCTGCGAGACGGGGATGTTGAAG
GATTCAGCGACGAGACCACGATCCGCTGGGTAGAGCCTGACGATGCCAAACAGACTGATGGCCGTCATGG
CAACGCTGCGCTGAGCTTTCCGACACGTTTCGGGCCCGCCCAGAAGACGCTGGACACCACGGTCGAAAGC
GTCACCAGTACCCGCACAAACGCGACCAGAGCCAACCCCGCCAGGGCCGTTTACACCGTCCCCACCAATT
CAACACTGATGGGTTCAGTCGCGATGACAGCCTTGATTGGCCGCGTACCGATCGATGGCACCGTCAATGA
CCCCTATCCCTTCAAAGTCTTGGTCGGCCCCGACAATCTGACGGCCAACGGCATCGATATCCCTGATGTG
GCTGGCGCGGTGTTCAGTGGCACCGCGTCCGGCGACTGGACGCTCTCATGCGTCAGGGGACAGGTACGCT
CAATCACCTTCGTTTTCCACGACGGCACCATCCGCACCCTTCCGGAAGACAGCGAACGCAGTCATCAGCA
AAGCAATGACCAGAACGGTCTCGGGTGGATCAGTGACCCCTACGGTATCCCGTGCGTGTCAGGCGAGCGC
CGCAGCAATGCCCAGCAGTATCTCGGTACACAGGCTTTGATCACCGCAGCAGGCGCAGGCGCGGCATCCC
TCATCGATTCGGACAGCGGTCAGATGTCCTACGCCGGTGCCGACGGCTCCCTCGGCACCGTGGGCATCAG
CAGCAACGAGGCTGTGGGCCGCATTCTCGCCGGCGGCGTACGCGACATGTCTGACTGGGTCAACAAACTC
TATGGCCAGGCCTTCGCAGCAGTCTATGTGAAGCCCGGCGCACACGTCGCCGTTCACCTCGAAAAACCGC
TCGCCATTGACTACGACACCGAAGGCCGCAAGGTCGACCATCGTACAGGAGAAAGCCATGCGCTCGAACT
GGACTAA
 Primer design