SecReT4
Protein ID: 261820920
T4SS name [ID]Tfc [694]
Gene symbol-
Locus tagPecwa_1629
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]1770248..1771150 [-]
Productsecreted protein
Component typeTfc13
UniProt IDD0KM58
KEGG IDpwa:Pecwa_1629
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 3.7e-121, Aligned region: 7..285
Protein Sequence: 300 a.a.     [Download]
>gi|261820920|ref|YP_003259026.1| secreted protein [Pectobacterium wasabiae WPP163]
MKHRRLCLIWLGLMALVQTPALHAVEILRWERLPLAVPLSVGQERIVFVDRNVRVGVPASIGDRLRVQSA
GGAIYLRASEPIEPTRLQLQDADSGALILLDIAATPAKDGEPALEPIRIVEGNATPPRYGQPPDNAPPAP
TADQARPAQRETPVAVVLTRYAAQSLYAPLRTLEPVPGIMRISLRRDLPLDTLLPTLPVEAKALASWRLE
DQWVTVVRLTHTGNGWIELDPRALQGDFLTATFQHTALGPRGSPEDTTVLYLVTRKHGLPQSLLPAIQRF
DPAMHLPATTPPTTEVHHAQ
 
Nucleotide Sequence: 903 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c1771150-1770248 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGAAACATCGTCGTCTCTGTCTCATCTGGCTGGGGCTGATGGCCTTGGTGCAGACTCCTGCGCTCCATG
CCGTGGAAATCCTGCGCTGGGAGCGGCTGCCACTTGCCGTGCCACTTTCTGTTGGGCAGGAACGCATTGT
GTTCGTAGATCGCAACGTCCGTGTCGGCGTCCCGGCCAGCATCGGCGACCGTCTGCGTGTACAGAGCGCA
GGTGGAGCCATCTACCTGCGTGCCAGCGAGCCTATCGAACCCACTCGATTGCAGTTGCAGGACGCCGACA
GCGGTGCGCTGATCCTGCTCGACATCGCGGCCACACCAGCCAAAGACGGCGAGCCTGCACTTGAGCCGAT
ACGCATCGTTGAGGGTAATGCCACCCCACCCCGCTATGGTCAGCCGCCAGACAACGCCCCCCCCGCCCCC
ACGGCAGACCAGGCCAGACCGGCGCAACGTGAAACACCAGTGGCCGTGGTACTCACACGTTACGCCGCAC
AAAGCCTGTACGCGCCATTACGCACCCTAGAGCCTGTGCCCGGCATAATGCGCATCAGCCTGCGCCGCGA
CCTGCCACTGGATACGCTGCTACCGACACTGCCTGTAGAGGCAAAAGCGCTGGCCTCATGGCGATTGGAA
GATCAGTGGGTCACTGTCGTGCGACTGACACATACAGGCAATGGCTGGATTGAACTCGATCCACGCGCAC
TACAAGGTGATTTCCTCACCGCCACTTTCCAGCATACGGCGCTCGGCCCACGCGGCTCTCCCGAAGACAC
CACGGTACTGTATCTGGTTACCCGCAAGCACGGACTGCCGCAGTCGCTACTGCCCGCCATCCAACGCTTT
GATCCTGCCATGCACTTGCCTGCCACCACGCCCCCGACAACGGAGGTACATCATGCGCAGTAA
 Primer design